BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_E20 (378 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 25 1.2 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 22 8.6 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 24.6 bits (51), Expect = 1.2 Identities = 6/22 (27%), Positives = 13/22 (59%) Frame = +1 Query: 205 VSVWEDNWEDDVIQDDFNQQLR 270 + W++ W+ D +Q D ++ R Sbjct: 934 IDCWQEEWDADALQQDASRHTR 955 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 21.8 bits (44), Expect = 8.6 Identities = 10/40 (25%), Positives = 18/40 (45%) Frame = +1 Query: 163 PRQNWGTEDADDEXVSVWEDNWEDDVIQDDFNQQLRQQLE 282 P+ W ED +DE ++ + ++ N+Q LE Sbjct: 1049 PKPQWDEEDLEDEQKAIGRRDTIHRILYQHKNKQDWSNLE 1088 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 276,665 Number of Sequences: 2352 Number of extensions: 4207 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 28646721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -