BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fprWP02_F_E20
(378 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 2.8
AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 20 8.4
>AF388659-3|AAK71993.1| 548|Apis mellifera
1D-myo-inositol-trisphosphate 3-kinaseisoform C protein.
Length = 548
Score = 21.8 bits (44), Expect = 2.8
Identities = 12/50 (24%), Positives = 21/50 (42%), Gaps = 2/50 (4%)
Frame = +1
Query: 91 QCNG*QTESXPCVCXKRMTSSKNFPRQN--WGTEDADDEXVSVWEDNWED 234
Q NG + C ++ P+ N WG + D+ S W+ ++ D
Sbjct: 157 QSNGEEVCLENCTGYQQYLRLLEVPQINLEWGEGSSGDDLSSEWDSDYTD 206
>AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha
protein precursor protein.
Length = 153
Score = 20.2 bits (40), Expect = 8.4
Identities = 6/8 (75%), Positives = 7/8 (87%)
Frame = -3
Query: 229 PSCLPKPI 206
P C+PKPI
Sbjct: 41 PGCVPKPI 48
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 75,137
Number of Sequences: 438
Number of extensions: 1144
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 51
effective length of database: 124,005
effective search space used: 9176370
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)
- SilkBase 1999-2023 -