Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP02_F_E20
         (378 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF388659-3|AAK71993.1|  548|Apis mellifera 1D-myo-inositol-trisp...    22   2.8  
AM420631-1|CAM06631.1|  153|Apis mellifera bursicon subunit alph...    20   8.4  

>AF388659-3|AAK71993.1|  548|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform C protein.
          Length = 548

 Score = 21.8 bits (44), Expect = 2.8
 Identities = 12/50 (24%), Positives = 21/50 (42%), Gaps = 2/50 (4%)
 Frame = +1

Query: 91  QCNG*QTESXPCVCXKRMTSSKNFPRQN--WGTEDADDEXVSVWEDNWED 234
           Q NG +     C   ++       P+ N  WG   + D+  S W+ ++ D
Sbjct: 157 QSNGEEVCLENCTGYQQYLRLLEVPQINLEWGEGSSGDDLSSEWDSDYTD 206


>AM420631-1|CAM06631.1|  153|Apis mellifera bursicon subunit alpha
           protein precursor protein.
          Length = 153

 Score = 20.2 bits (40), Expect = 8.4
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 229 PSCLPKPI 206
           P C+PKPI
Sbjct: 41  PGCVPKPI 48


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 75,137
Number of Sequences: 438
Number of extensions: 1144
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 51
effective length of database: 124,005
effective search space used:  9176370
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)