BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_E19 (577 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68753-7|CAA92987.1| 240|Caenorhabditis elegans Hypothetical pr... 28 5.5 AF077545-2|AAC26305.3| 356|Caenorhabditis elegans Hypothetical ... 27 9.5 >Z68753-7|CAA92987.1| 240|Caenorhabditis elegans Hypothetical protein ZC518.4 protein. Length = 240 Score = 27.9 bits (59), Expect = 5.5 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 276 IQNVXKIXLLSEVLNFLRFIQSGK 347 IQN +I ++ ++FL+F+QSGK Sbjct: 55 IQNELRIWIIKRGVDFLQFLQSGK 78 >AF077545-2|AAC26305.3| 356|Caenorhabditis elegans Hypothetical protein H41C03.2 protein. Length = 356 Score = 27.1 bits (57), Expect = 9.5 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = +3 Query: 426 SWTRELLWHNLIELF-GTGISLFNIIGLKQRLSKF-LKYVWWNKPV 557 S T E HN E+F G+ +++ N Q +++ LK WW KPV Sbjct: 292 SQTIETAHHNSFEIFYGSHMAVDNYKICNQPETEYCLKGSWWKKPV 337 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,125,945 Number of Sequences: 27780 Number of extensions: 234336 Number of successful extensions: 520 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 508 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 520 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1194789454 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -