BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_E12 (488 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methy... 24 3.2 AJ973474-1|CAJ01521.1| 191|Anopheles gambiae hypothetical prote... 23 7.4 AJ697734-1|CAG26927.1| 191|Anopheles gambiae putative chemosens... 23 7.4 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 22 9.8 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 22 9.8 >AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methylase protein. Length = 459 Score = 23.8 bits (49), Expect = 3.2 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 168 RLWSMQEQTPLAIQPARP 221 R+W++Q +TP P RP Sbjct: 29 RIWNIQMETPADHNPERP 46 >AJ973474-1|CAJ01521.1| 191|Anopheles gambiae hypothetical protein protein. Length = 191 Score = 22.6 bits (46), Expect = 7.4 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 361 ALRTFTIFCSSIKKALTMRCLTHLWQRTP 275 ALRT CS I+K ++ +T L+ P Sbjct: 74 ALRTKCARCSPIQKENALKIITRLYYDYP 102 >AJ697734-1|CAG26927.1| 191|Anopheles gambiae putative chemosensory protein CSP5 protein. Length = 191 Score = 22.6 bits (46), Expect = 7.4 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 361 ALRTFTIFCSSIKKALTMRCLTHLWQRTP 275 ALRT CS I+K ++ +T L+ P Sbjct: 74 ALRTKCARCSPIQKENALKIITRLYYDYP 102 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 22.2 bits (45), Expect = 9.8 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +2 Query: 2 ELFLXHQLSKSLKMVQRLTFRRRLSYNTKSNQRRIVR 112 EL L H+L+ S K + L RR+ + ++ I+R Sbjct: 1100 ELDLGHRLTLSRKTLNVLDTRRKSMAEQRKIRKSIIR 1136 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 22.2 bits (45), Expect = 9.8 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +3 Query: 264 RVYGGVLCHKCVKQ 305 ++Y GVL KC+K+ Sbjct: 290 QIYMGVLTQKCIKE 303 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 398,369 Number of Sequences: 2352 Number of extensions: 7354 Number of successful extensions: 19 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43131618 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -