BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_D21 (550 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 27 0.41 AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. 23 6.6 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 27.1 bits (57), Expect = 0.41 Identities = 16/56 (28%), Positives = 29/56 (51%) Frame = -1 Query: 499 INLNLPFIYVDRLGVHIKKKMLQATIEHRTNTPQNHNSTITITYKHYVYYYINTNE 332 I L PF+ D L +H++ ML ++E++ + + + I T Y +NT+E Sbjct: 920 IILKAPFLQKDVLNIHVRFFML--SLENKPHVFDCYTTVIPHTVLTQYNYTVNTDE 973 >AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. Length = 437 Score = 23.0 bits (47), Expect = 6.6 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +1 Query: 40 QQAMEPRSKSLSRRQPITYCVMYDQQ*NC 126 Q A + +S R P Y YDQ +C Sbjct: 308 QPARKRKSSKTDHRHPFQYHPTYDQHKSC 336 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 441,137 Number of Sequences: 2352 Number of extensions: 7371 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -