BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_D21 (550 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY069420-1|AAL39565.1| 514|Drosophila melanogaster LD13436p pro... 28 9.6 AE013599-476|AAF59211.1| 514|Drosophila melanogaster CG12042-PA... 28 9.6 >AY069420-1|AAL39565.1| 514|Drosophila melanogaster LD13436p protein. Length = 514 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = -1 Query: 478 IYVDRLGVHIKKKMLQATIEHRTNTPQNHNSTITITYKHYVYYYI 344 +Y R + IK+ + EH P+ H ++I +H+ Y++ Sbjct: 274 LYPQRRSLWIKRSLRCRQCEHNLIKPEYHPTSIKYRIQHFASYHV 318 >AE013599-476|AAF59211.1| 514|Drosophila melanogaster CG12042-PA protein. Length = 514 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = -1 Query: 478 IYVDRLGVHIKKKMLQATIEHRTNTPQNHNSTITITYKHYVYYYI 344 +Y R + IK+ + EH P+ H ++I +H+ Y++ Sbjct: 274 LYPQRRSLWIKRSLRCRQCEHNLIKPEYHPTSIKYRIQHFASYHV 318 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,155,894 Number of Sequences: 53049 Number of extensions: 274312 Number of successful extensions: 679 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 656 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 678 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2089831299 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -