Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP02_F_D20
         (522 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY855337-1|AAW47987.1|  510|Apis mellifera tyrosine hydroxylase ...    23   2.5  
AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic ac...    22   3.3  

>AY855337-1|AAW47987.1|  510|Apis mellifera tyrosine hydroxylase
           protein.
          Length = 510

 Score = 22.6 bits (46), Expect = 2.5
 Identities = 9/12 (75%), Positives = 10/12 (83%)
 Frame = +2

Query: 197 YRRKFKKGQEEE 232
           YRR FKK QEE+
Sbjct: 259 YRRNFKKMQEEK 270


>AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic
           acetylcholine receptoralpha7-1 protein.
          Length = 555

 Score = 22.2 bits (45), Expect = 3.3
 Identities = 12/34 (35%), Positives = 17/34 (50%)
 Frame = +1

Query: 43  GLCAYSGYKIYPGHGKTMVKVDGKTFTFLNSKCE 144
           G C Y    + PG  K+  K+D   F F + +CE
Sbjct: 134 GTCLY----VPPGIFKSTCKIDITWFPFDDQRCE 163


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 113,661
Number of Sequences: 438
Number of extensions: 1949
Number of successful extensions: 10
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 14600229
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)