BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_D19 (535 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 6.0 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 6.0 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 6.0 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 7.9 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 21 7.9 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 6.0 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 285 PTNAPHNVDCTTVCS 241 P PH+ CTT+ S Sbjct: 1081 PEQPPHDTTCTTLTS 1095 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 6.0 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 406 CYIVLQFFXCIAYCFISG 353 C + L FF CIA + G Sbjct: 454 CLLFLMFFECIAISWAFG 471 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 6.0 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 406 CYIVLQFFXCIAYCFISG 353 C + L FF CIA + G Sbjct: 507 CLLFLMFFECIAISWAFG 524 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.0 bits (42), Expect = 7.9 Identities = 6/20 (30%), Positives = 12/20 (60%) Frame = -3 Query: 278 MHRTMWIAQLYAVQEKLRRI 219 MH MW+ Q++ + + + I Sbjct: 1 MHHRMWLQQIFILLQMIHLI 20 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 21.0 bits (42), Expect = 7.9 Identities = 10/33 (30%), Positives = 13/33 (39%) Frame = +2 Query: 86 GCLQVLSYQLFRERNENDYXVLNRPLPGGPQTG 184 GC SY R+R D + P P+ G Sbjct: 620 GCKDASSYCGLRDRKYPDARAMGYPFDRQPRAG 652 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,978 Number of Sequences: 438 Number of extensions: 3275 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15090993 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -