BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_D10 (653 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21409| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 >SB_21409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 45.6 bits (103), Expect = 4e-05 Identities = 43/144 (29%), Positives = 65/144 (45%), Gaps = 13/144 (9%) Frame = +2 Query: 203 DIQIEGFNPSAEEADEGTDSAVESGVDIVLNHRLVETYAFGDKKSYTLYLKDYMKKLVXK 382 D + G N SAE+A + + +G ++V+ +RLVE + K K Y+KK+ Sbjct: 47 DENLIGGNKSAEDACDDVEDGCTTGCNVVMANRLVE-IPYKTFKELLAEFKPYIKKVKEH 105 Query: 383 L-EEKAPD-QVEVFKTNMNKVMKDILGRFKELQFFTGESMDCD-----GMVAMMEY--RD 535 + EE PD +V+ F+ + I FKE QFF DCD + M Y +D Sbjct: 106 MKEEGCPDEEVKGFEKAAMDYILSIKKNFKEYQFF---QPDCDLGGGAHCIVFMWYPEKD 162 Query: 536 FDGTQ----IPIMMFFKHGLXXEK 595 G P++ FKH + K Sbjct: 163 LRGVDQDGFSPVLTVFKHAVKQVK 186 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,724,279 Number of Sequences: 59808 Number of extensions: 330505 Number of successful extensions: 650 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 613 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 650 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -