BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_D10 (653 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g16640.1 68416.m02127 translationally controlled tumor family... 85 5e-17 At3g05540.1 68416.m00607 translationally controlled tumor family... 79 2e-15 At2g17050.1 68415.m01968 disease resistance protein (TIR-NBS-LRR... 34 0.072 At4g29060.1 68417.m04157 elongation factor Ts family protein sim... 28 4.7 At4g12570.1 68417.m01983 ubiquitin-protein ligase, putative simi... 28 4.7 At1g76380.3 68414.m08876 DNA-binding bromodomain-containing prot... 28 6.2 At1g76380.1 68414.m08874 DNA-binding bromodomain-containing prot... 28 6.2 At1g63910.1 68414.m07236 myb family transcription factor (MYB103... 28 6.2 At5g49030.1 68418.m06067 tRNA synthetase class I (I, L, M and V)... 27 8.2 At5g42270.1 68418.m05145 FtsH protease, putative similar to FtsH... 27 8.2 At1g50250.1 68414.m05634 cell division protein ftsH homolog 1, c... 27 8.2 >At3g16640.1 68416.m02127 translationally controlled tumor family protein similar to translationally controlled tumor protein GB:AAD10032 from [Hevea brasiliensis] Length = 168 Score = 84.6 bits (200), Expect = 5e-17 Identities = 55/140 (39%), Positives = 72/140 (51%), Gaps = 2/140 (1%) Frame = +2 Query: 182 W*REHRADIQIEGFNPSAEEA--DEGTDSAVESGVDIVLNHRLVETYAFGDKKSYTLYLK 355 W D+ I G NPSAEE DEG D + + VDIV RL E + DKK + Y+K Sbjct: 35 WVTVGAVDVNI-GANPSAEEGGEDEGVDDSTQKVVDIVDTFRLQEQPTY-DKKGFIAYIK 92 Query: 356 DYMKKLVXKLEEKAPDQVEVFKTNMNKVMKDILGRFKELQFFTGESMDCDGMVAMMEYRD 535 Y+K L KL E+ DQ VFK + K +L R + QFF GE M D + Y+ Sbjct: 93 KYIKLLTPKLSEE--DQA-VFKKGIEGATKFLLPRLSDFQFFVGEGMHDDSTLVFAYYK- 148 Query: 536 FDGTQIPIMMFFKHGLXXEK 595 +G+ P ++F HGL K Sbjct: 149 -EGSTNPTFLYFAHGLKEVK 167 Score = 38.7 bits (86), Expect = 0.003 Identities = 15/37 (40%), Positives = 28/37 (75%), Gaps = 1/37 (2%) Frame = +1 Query: 82 MKIYKDIITGDEMFSDTYKMKLVDE-VIYEVTGRLVT 189 M +Y+D++TGDE+ SD++ K ++ +++EV G+ VT Sbjct: 1 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVT 37 >At3g05540.1 68416.m00607 translationally controlled tumor family protein similar to translationally controlled tumor protein GB:AAD10032 from [Hevea brasiliensis] Length = 156 Score = 79.4 bits (187), Expect = 2e-15 Identities = 46/128 (35%), Positives = 72/128 (56%), Gaps = 3/128 (2%) Frame = +2 Query: 209 QIEGFNPSAEEA--DEGTDSAVESGVDIVLNHRLVETYAFGDKKSYTLYLKDYMKKLVXK 382 ++EG NPS EE DEG D VDI+ RL E +F DKK + +++K Y+K+L K Sbjct: 30 EVEGKNPSGEEGGEDEGVDDQAVKVVDIIDTFRLQEQPSF-DKKQFVMFMKRYIKQLSPK 88 Query: 383 LEEKAPDQVEVFKTNMNKVMKDILGRFKELQFFTGESMDC-DGMVAMMEYRDFDGTQIPI 559 L+ + E+FK ++ K ++ + K+ QFF GESM+ +G + YR +G P Sbjct: 89 LDS---ENQELFKKHIESATKFLMSKLKDFQFFVGESMEGEEGSLVFAYYR--EGATDPT 143 Query: 560 MMFFKHGL 583 ++ +GL Sbjct: 144 FLYLAYGL 151 Score = 36.3 bits (80), Expect = 0.018 Identities = 15/41 (36%), Positives = 29/41 (70%), Gaps = 1/41 (2%) Frame = +1 Query: 82 MKIYKDIITGDEMFSDTYKMKLVDE-VIYEVTGRLVTRAQG 201 M +Y+DI+TGDE+ SD++ K ++ +++EV G+ + +G Sbjct: 1 MLVYQDILTGDELLSDSFPYKEIENGMLWEVEGKNPSGEEG 41 >At2g17050.1 68415.m01968 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1355 Score = 34.3 bits (75), Expect = 0.072 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 8/91 (8%) Frame = +2 Query: 251 GTDSAVESGVDIVLNHRLVETYAFGDKKSYTLYLK-------DYMKKLVXKLEEKAPDQV 409 G D +SG++ + + + Y G+ + +LY + D M+ + KL P + Sbjct: 184 GIDWRKQSGLETLAPYYISVKYFSGNPLALSLYEEMLSHMKSDKMEVKLLKLNHPPPQIM 243 Query: 410 EVFKTNMNKVMKDILGRFKELQ-FFTGESMD 499 EVFK+N N + ++ F ++ FF GE D Sbjct: 244 EVFKSNYNALNENEKSMFLDIACFFRGEKAD 274 >At4g29060.1 68417.m04157 elongation factor Ts family protein similar to SP|P35019 Elongation factor Ts (EF-Ts) {Galdieria sulphuraria}; contains Pfam profiles PF00627: UBA/TS-N domain, PF00889: Elongation factor TS, PF00575: S1 RNA binding domain Length = 953 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 215 EGFNPSAEEADEGTDSAVESG 277 EGF P+AEEAD+G S + G Sbjct: 272 EGFLPTAEEADDGIGSMMMGG 292 >At4g12570.1 68417.m01983 ubiquitin-protein ligase, putative similar to SP|P39940 Ubiquitin--protein ligase RSP5 (EC 6.3.2.-) {Saccharomyces cerevisiae}; contains Pfam profiles PF00240: Ubiquitin family, PF00632: HECT-domain (ubiquitin-transferase) Length = 873 Score = 28.3 bits (60), Expect = 4.7 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = -2 Query: 316 VCFD*PVVQDYVNSALDGRVRALVSLFSRRIKTLDLDISPVLSS 185 V F P+V ++AL+ +R L LF + T+DL + V SS Sbjct: 369 VAFPIPIVLPMQSTALEAEIRHLHRLFGSLLTTMDLCMCRVESS 412 >At1g76380.3 68414.m08876 DNA-binding bromodomain-containing protein contains bromodomain, INTERPRO:IPR001487 Length = 579 Score = 27.9 bits (59), Expect = 6.2 Identities = 21/83 (25%), Positives = 31/83 (37%), Gaps = 6/83 (7%) Frame = +2 Query: 203 DIQIEGFNPSAEEADEGTDSAVESGVDIVLNHRLVETYAFGDKKSYTLYLKDYMKKLVXK 382 D+ + N + + T DI+L LVE+ DKK L KK Sbjct: 104 DLDSDARNRRKIDGSDNTGEKASKATDILLQRSLVESTPLPDKKLLFFILDRVQKKDTYG 163 Query: 383 L------EEKAPDQVEVFKTNMN 433 + E+ PD E+ K M+ Sbjct: 164 VYSDPADPEELPDYYEIIKNPMD 186 >At1g76380.1 68414.m08874 DNA-binding bromodomain-containing protein contains bromodomain, INTERPRO:IPR001487 Length = 579 Score = 27.9 bits (59), Expect = 6.2 Identities = 21/83 (25%), Positives = 31/83 (37%), Gaps = 6/83 (7%) Frame = +2 Query: 203 DIQIEGFNPSAEEADEGTDSAVESGVDIVLNHRLVETYAFGDKKSYTLYLKDYMKKLVXK 382 D+ + N + + T DI+L LVE+ DKK L KK Sbjct: 104 DLDSDARNRRKIDGSDNTGEKASKATDILLQRSLVESTPLPDKKLLFFILDRVQKKDTYG 163 Query: 383 L------EEKAPDQVEVFKTNMN 433 + E+ PD E+ K M+ Sbjct: 164 VYSDPADPEELPDYYEIIKNPMD 186 >At1g63910.1 68414.m07236 myb family transcription factor (MYB103) contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 370 Score = 27.9 bits (59), Expect = 6.2 Identities = 17/52 (32%), Positives = 22/52 (42%) Frame = -3 Query: 192 SRHQPTGHFVNNFIDQFHFVGVREHLITSDNVLIDLHFDGLEAIKNNKNRKN 37 SRHQP+ V D E T+ + + +LHFDG N N N Sbjct: 124 SRHQPSVTTVTLNADTTSIATTIEASTTTTSTIDNLHFDGFTDSPNQLNFTN 175 >At5g49030.1 68418.m06067 tRNA synthetase class I (I, L, M and V) family protein similar to SP|P41972 Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA ligase) (IleRS) {Staphylococcus aureus}; contains Pfam profile PF00133: tRNA synthetases class I (I, L, M and V) Length = 1093 Score = 27.5 bits (58), Expect = 8.2 Identities = 12/31 (38%), Positives = 20/31 (64%), Gaps = 3/31 (9%) Frame = +2 Query: 428 MNKVMKDILGRFKELQFFTGE---SMDCDGM 511 +NK++KDI+ R+K LQ + + DC G+ Sbjct: 167 LNKILKDIINRYKLLQNYKVQYVPGWDCHGL 197 >At5g42270.1 68418.m05145 FtsH protease, putative similar to FtsH protease GI:13183728 from [Medicago sativa] Length = 704 Score = 27.5 bits (58), Expect = 8.2 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +2 Query: 221 FNPSAEEADEG--TDSAVESGVDIVLNHRLVETYAFGDKKSYTLYLKDYMK 367 F PS E + G + S +E+ + + L R+ E FGD+ T D+M+ Sbjct: 546 FAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQ 596 >At1g50250.1 68414.m05634 cell division protein ftsH homolog 1, chloroplast (FTSH1) (FTSH) identical to SP:Q39102 Cell division protein ftsH homolog 1, chloroplast precursor (EC 3.4.24.-) [Arabidopsis thaliana] Length = 716 Score = 27.5 bits (58), Expect = 8.2 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +2 Query: 221 FNPSAEEADEG--TDSAVESGVDIVLNHRLVETYAFGDKKSYTLYLKDYMK 367 F PS E + G + S +E+ + + L R+ E FGD+ T D+M+ Sbjct: 558 FAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQ 608 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,581,390 Number of Sequences: 28952 Number of extensions: 239307 Number of successful extensions: 671 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 651 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 666 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -