BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_D08 (653 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 27 0.52 AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 23 8.4 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 27.1 bits (57), Expect = 0.52 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +2 Query: 296 ALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHS 412 ALD FTE S + L + + +A+A+VFP HS Sbjct: 249 ALDVASFTERVTSAESLERVMTEACDAAMARVFPSQGHS 287 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = +1 Query: 247 QSMQYCDAVSQSVRSGSTGPG 309 Q++QY D ++++R+ S PG Sbjct: 4 QAIQYADYFARAMRNESAAPG 24 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 704,014 Number of Sequences: 2352 Number of extensions: 14671 Number of successful extensions: 26 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -