BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_D05 (655 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 23 1.7 DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 pro... 23 2.2 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 21 8.9 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 23.4 bits (48), Expect = 1.7 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = +2 Query: 179 LKSNKKLKWALDFNQKNKQLSTELPSPPGYSQSSNANYAESSKDSD 316 LK+ + + D + + L S PG+ ++ N+ A S KD D Sbjct: 40 LKTTQSVSVTKDQDVSSSVNRFRLRSRPGHRKTDNSLSATSKKDKD 85 >DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 protein. Length = 377 Score = 23.0 bits (47), Expect = 2.2 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 278 SNANYAESSKDSDSNLLLIKKLWDVALGPLKQV 376 ++ NYA D D N+ ++ + D+ G LK+V Sbjct: 53 THINYAFVGLDKDCNIQVLDEENDINQGGLKRV 85 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 21.0 bits (42), Expect = 8.9 Identities = 8/25 (32%), Positives = 9/25 (36%) Frame = -1 Query: 439 HHYWKYRDRVTSHVHNKKIHGYLFQ 365 H Y + H HN H Y Q Sbjct: 279 HEYNSFNWTANGHGHNTSSHNYYAQ 303 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,574 Number of Sequences: 336 Number of extensions: 3394 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16865010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -