BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_D03 (330 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g46240.1 68415.m05750 IQ domain-containing protein / BAG doma... 29 0.57 At4g29410.1 68417.m04200 60S ribosomal protein L28 (RPL28C) unkn... 27 3.0 At2g19730.1 68415.m02305 60S ribosomal protein L28 (RPL28A) 27 3.0 At1g69523.1 68414.m07991 UbiE/COQ5 methyltransferase family prot... 27 3.0 At4g38150.1 68417.m05386 pentatricopeptide (PPR) repeat-containi... 27 4.0 At5g66850.1 68418.m08428 protein kinase family protein contains ... 26 7.0 At1g53050.1 68414.m06007 protein kinase family protein contains ... 25 9.3 >At2g46240.1 68415.m05750 IQ domain-containing protein / BAG domain-containing protein contains Pfam profiles PF00612: IQ calmodulin-binding motif, PF02179: BAG (Apoptosis regulator Bcl-2 protein) domain Length = 1043 Score = 29.5 bits (63), Expect = 0.57 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +2 Query: 158 HRPMQGYPSSCFSHPPLPEAHQ 223 H P Y SC+ HPP P +Q Sbjct: 73 HPPHASYAPSCYVHPPFPVGYQ 94 >At4g29410.1 68417.m04200 60S ribosomal protein L28 (RPL28C) unknown protein chromosome II BAC F6F22 - Arabidopsis thaliana,PID:g3687251 Length = 143 Score = 27.1 bits (57), Expect = 3.0 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +3 Query: 147 NHYRTDLCKATLRRASAILRSQR 215 N+YR DL KA L R SAI + R Sbjct: 108 NYYRPDLKKAALARLSAISKGLR 130 >At2g19730.1 68415.m02305 60S ribosomal protein L28 (RPL28A) Length = 143 Score = 27.1 bits (57), Expect = 3.0 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +3 Query: 147 NHYRTDLCKATLRRASAILRSQR 215 N+YR DL KA L R SAI + R Sbjct: 108 NYYRPDLKKAALARLSAISKGLR 130 >At1g69523.1 68414.m07991 UbiE/COQ5 methyltransferase family protein low similarity to SP|Q05197 Phosphatidylethanolamine N-methyltransferase (EC 2.1.1.17) [Rhodopseudomonas sphaeroides] {Rhodobacter sphaeroides}; contains Pfam profile PF01209: methlytransferase, UbiE/COQ5 family Length = 300 Score = 27.1 bits (57), Expect = 3.0 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 175 LPFVVLQPSSAPRGPSKQKRLRQPQP 252 +PF+ + PS A KRLR P+P Sbjct: 63 MPFLPISPSHASTSTEDLKRLRPPKP 88 >At4g38150.1 68417.m05386 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 302 Score = 26.6 bits (56), Expect = 4.0 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +2 Query: 149 PLPHRPMQGYPSS-CFSHPPLPEAHQSKK 232 PLP+RP++G SS PP +AH K Sbjct: 48 PLPNRPLRGERSSNSHREPPARQAHNLGK 76 >At5g66850.1 68418.m08428 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain; identical to cDNA MAP3K gamma protein kinase GI:2315152 Length = 716 Score = 25.8 bits (54), Expect = 7.0 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 196 PSSAPRGPSKQKRLRQPQPSR 258 P +P+ S +K++R PQPSR Sbjct: 249 PIHSPQPRSPRKQIRSPQPSR 269 >At1g53050.1 68414.m06007 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 694 Score = 25.4 bits (53), Expect = 9.3 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 161 RPMQGYPSSCFSHPPLPEAHQSKKG*DSRNQVG 259 RP+ PSS +PP E + +SR QVG Sbjct: 421 RPLPCDPSSLPKYPPSKELDARMRDEESRRQVG 453 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,037,187 Number of Sequences: 28952 Number of extensions: 108184 Number of successful extensions: 254 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 252 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 253 length of database: 12,070,560 effective HSP length: 71 effective length of database: 10,014,968 effective search space used: 380568784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -