BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_C21 (370 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_02_0115 - 11248021-11248101,11249017-11249118 57 5e-09 05_03_0661 - 16726958-16726966,16727133-16727234 54 3e-08 >01_02_0115 - 11248021-11248101,11249017-11249118 Length = 60 Score = 56.8 bits (131), Expect = 5e-09 Identities = 26/59 (44%), Positives = 37/59 (62%) Frame = +3 Query: 57 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLAHGSKIFKESKVLQEG*PEASQATRE 233 MAKSKNHT HNQ+ KAH+NGIKKP++ R ST K + + ++ ++ +A E Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRHRQTSTKGMDPKFLRNQRYSRKHNKKSGEAESE 59 >05_03_0661 - 16726958-16726966,16727133-16727234 Length = 36 Score = 54.4 bits (125), Expect = 3e-08 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +3 Query: 57 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHEST 152 MAKSKNHT HNQ+ KAH+NGIKKP++ R ST Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRHRQTST 32 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,782,025 Number of Sequences: 37544 Number of extensions: 133705 Number of successful extensions: 466 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 459 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 465 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 576724416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -