BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_C21 (370 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25197| Best HMM Match : TatC (HMM E-Value=1.8) 30 0.51 SB_14036| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.67 SB_40598| Best HMM Match : Stap_Strp_toxin (HMM E-Value=2.7) 29 0.89 SB_36850| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.89 SB_24918| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.89 SB_44094| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.89 SB_45518| Best HMM Match : Prothymosin (HMM E-Value=0.9) 29 1.2 SB_19567| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_6986| Best HMM Match : Ribosomal_L29e (HMM E-Value=1.6) 29 1.6 SB_8591| Best HMM Match : DUF601 (HMM E-Value=0.23) 29 1.6 SB_36161| Best HMM Match : SecIII_SopE_N (HMM E-Value=4.1) 27 3.6 SB_33977| Best HMM Match : CUE (HMM E-Value=0.52) 27 3.6 SB_51620| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_34| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_31788| Best HMM Match : Kazal_1 (HMM E-Value=0) 27 6.3 SB_29377| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_54637| Best HMM Match : DUF1621 (HMM E-Value=3) 26 8.3 SB_48996| Best HMM Match : ASC (HMM E-Value=7.1e-08) 26 8.3 SB_48994| Best HMM Match : ASC (HMM E-Value=1.3e-11) 26 8.3 SB_2814| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.3 SB_3594| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.3 >SB_25197| Best HMM Match : TatC (HMM E-Value=1.8) Length = 622 Score = 30.3 bits (65), Expect = 0.51 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +3 Query: 48 LIKMAKSKNHTNHNQNRKAH-RNGIKKPRKTRHESTLAHGSKI 173 LI KSK+H NHN+ + H + I K H+ T+A K+ Sbjct: 571 LIVYCKSKHHANHNKGCERHFEDDINKCGCRNHDHTIAQYYKL 613 >SB_14036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 658 Score = 29.9 bits (64), Expect = 0.67 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +1 Query: 46 NSSKWQSQRIIQIITKTAKLTEMVSKSQGRPGTNPPLRMDPKFLR 180 NS+ WQ+ I + + K EM S + R N + DPK +R Sbjct: 88 NSTSWQNINIHESLAKELARDEMQSNERRRAQANSEQKTDPKGVR 132 >SB_40598| Best HMM Match : Stap_Strp_toxin (HMM E-Value=2.7) Length = 192 Score = 29.5 bits (63), Expect = 0.89 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +3 Query: 60 AKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLAHGSKI 173 +K+ N TN NQ K P+KT ++T+ S + Sbjct: 153 SKNNNQTNRNQGNTGITENTKSPKKTNIDATVPSDSSV 190 >SB_36850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1008 Score = 29.5 bits (63), Expect = 0.89 Identities = 16/50 (32%), Positives = 21/50 (42%) Frame = +3 Query: 51 IKMAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLAHGSKIFKESKVLQE 200 IK N HNQ + + KK RK RH + KE K+L + Sbjct: 123 IKQTSDNNKPQHNQKNTSKK---KKKRKDRHRKKQDQDPEPLKEKKILTQ 169 >SB_24918| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 336 Score = 29.5 bits (63), Expect = 0.89 Identities = 10/22 (45%), Positives = 18/22 (81%) Frame = -1 Query: 178 LKILDPCARVDSCLVFLGFLIP 113 + ++ PCA + SC++FLGF++P Sbjct: 73 VNLIIPCALI-SCMIFLGFILP 93 >SB_44094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 29.5 bits (63), Expect = 0.89 Identities = 13/40 (32%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = -1 Query: 232 SRVAWLASGY-PSCKTFDSLKILDPCARVDSCLVFLGFLI 116 +R WL + P+ + + S ++LD CAR D L++L ++ Sbjct: 67 TRPRWLCTRLTPNTEGYFSTRVLDGCARADHVLLYLSAML 106 >SB_45518| Best HMM Match : Prothymosin (HMM E-Value=0.9) Length = 413 Score = 29.1 bits (62), Expect = 1.2 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 54 KMAKSKNHTNHNQNRKAHRNGIKKPRKTRHEST 152 K AKSK NH ++ K R KK ++T +ST Sbjct: 145 KNAKSKIKRNHGEDNKPKRISTKKRKRTDKDST 177 >SB_19567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1383 Score = 29.1 bits (62), Expect = 1.2 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = +3 Query: 99 KAHRNGIKKPRKTRHES 149 K HRNGIKKPR R+ S Sbjct: 175 KWHRNGIKKPRTNRYPS 191 >SB_6986| Best HMM Match : Ribosomal_L29e (HMM E-Value=1.6) Length = 371 Score = 28.7 bits (61), Expect = 1.6 Identities = 15/41 (36%), Positives = 27/41 (65%), Gaps = 1/41 (2%) Frame = +3 Query: 63 KSKNHTNHNQNRKAHRNGIKKPRKTRH-ESTLAHGSKIFKE 182 +S N T HN+N++A ++G + ++ RH ES A +KI ++ Sbjct: 216 RSNNVTKHNRNQQA-KDGEPRKKRLRHGESDHAQRAKIIED 255 >SB_8591| Best HMM Match : DUF601 (HMM E-Value=0.23) Length = 3368 Score = 28.7 bits (61), Expect = 1.6 Identities = 26/86 (30%), Positives = 40/86 (46%), Gaps = 4/86 (4%) Frame = +3 Query: 48 LIKMAKSKNHTNHNQNRKAH---RNGIKKPRKTRHESTLAHGSKIFKESKVLQEG*PEAS 218 L ++A++ N R+ H +NG KP+ T + TL K+FK SK ++ +A Sbjct: 2313 LTEVARAGAAAKLNSRRRTHEIDKNG--KPKLTTADFTLVKKKKVFKPSKKKRDPFKDAI 2370 Query: 219 QAT-REGG*EKSYPRSKGQEMNISCK 293 + T RE EK K + N K Sbjct: 2371 EETLREIEEEKRLQEQKKVKDNEEVK 2396 >SB_36161| Best HMM Match : SecIII_SopE_N (HMM E-Value=4.1) Length = 535 Score = 27.5 bits (58), Expect = 3.6 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = +3 Query: 54 KMAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLAHGSKIFKE 182 K K K +H N NG+ P+K + + H K F + Sbjct: 92 KFKKIKKEGDHGNNNTEKPNGVSSPKKKKKKHHHKHEEKHFTD 134 >SB_33977| Best HMM Match : CUE (HMM E-Value=0.52) Length = 1183 Score = 27.5 bits (58), Expect = 3.6 Identities = 9/36 (25%), Positives = 18/36 (50%) Frame = +1 Query: 43 ENSSKWQSQRIIQIITKTAKLTEMVSKSQGRPGTNP 150 E +W +R++ + + KL E + ++GR P Sbjct: 1031 EKYREWHMKRVLPLFVQDTKLREKIENAEGRTSGGP 1066 >SB_51620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 451 Score = 27.1 bits (57), Expect = 4.8 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 57 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHE 146 + S +HN + R GIK+PR+++ E Sbjct: 342 LTTSPTMISHNNQQNDSRRGIKRPRRSQEE 371 >SB_34| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 27.1 bits (57), Expect = 4.8 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 69 KNHTN-HNQNRKAHRNGIKKPRKTRHESTLAHGSKIFKESK 188 +NH HN+NRK N I+K R+ + +I S+ Sbjct: 66 RNHKEPHNRNRKEPGNRIRKVEHNRNRKDYSRDERIHNRSR 106 >SB_31788| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 352 Score = 26.6 bits (56), Expect = 6.3 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +3 Query: 45 KLIKMAKSKNHTNHNQNRKAHRNGIKKPRKTRHEST 152 K IK AK N+N RK G K+P++ R ++T Sbjct: 86 KPIKKAKVSK-VNNNGRRKEKNRGQKRPKRCRPDTT 120 >SB_29377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 26.6 bits (56), Expect = 6.3 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 227 SRGRLREKLPEKQRPRNE 280 SRGR EK PEKQR +++ Sbjct: 267 SRGRSAEKSPEKQRDKSD 284 >SB_54637| Best HMM Match : DUF1621 (HMM E-Value=3) Length = 265 Score = 26.2 bits (55), Expect = 8.3 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +3 Query: 57 MAKSKNHT-NHNQNRKAHRNGIKKPRKTRHESTLAH 161 + +NH N N++ KA G K+P +H LA+ Sbjct: 117 LVSCENHKINRNKDHKAFTEGCKEPEGPKHRYFLAN 152 >SB_48996| Best HMM Match : ASC (HMM E-Value=7.1e-08) Length = 294 Score = 26.2 bits (55), Expect = 8.3 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 99 CGFGYDLYDSLT 64 CGFGY LY S+T Sbjct: 41 CGFGYQLYKSIT 52 >SB_48994| Best HMM Match : ASC (HMM E-Value=1.3e-11) Length = 538 Score = 26.2 bits (55), Expect = 8.3 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 99 CGFGYDLYDSLT 64 CGFGY LY S+T Sbjct: 41 CGFGYQLYKSIT 52 >SB_2814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 896 Score = 26.2 bits (55), Expect = 8.3 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +1 Query: 100 KLTEMVSKSQGRPGTNPPLRMDPKFLRNQRFC 195 +++ M++ G P PP ++DP+ LR +C Sbjct: 667 RVSHMLAGEPGVPIGYPPRQLDPELLRYVMYC 698 >SB_3594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 26.2 bits (55), Expect = 8.3 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +3 Query: 48 LIKMAKSKNHTNHNQNRKAHRNGIKKPRKTRH 143 +I + + H +HN +R + N IK + RH Sbjct: 114 VIGVVRHVRHDDHNLSRSHNNNAIKSRNQNRH 145 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,105,786 Number of Sequences: 59808 Number of extensions: 158252 Number of successful extensions: 524 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 498 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 522 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 594991920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -