BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_C21 (370 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z49148-1|CAA89008.1| 159|Homo sapiens ribosomal protein L29 pro... 58 7e-09 U49083-1|AAC50647.1| 159|Homo sapiens HIP protein. 58 7e-09 U10248-1|AAC50499.1| 159|Homo sapiens ribosomal protein L29 pro... 58 7e-09 BC071909-1|AAH71909.1| 161|Homo sapiens ribosomal protein L29 p... 58 7e-09 BC071663-1|AAH71663.1| 159|Homo sapiens ribosomal protein L29 p... 58 7e-09 BC070481-1|AAH70481.1| 159|Homo sapiens ribosomal protein L29 p... 58 7e-09 BC070190-1|AAH70190.1| 159|Homo sapiens ribosomal protein L29 p... 58 7e-09 BC008926-1|AAH08926.1| 159|Homo sapiens ribosomal protein L29 p... 58 7e-09 AL450405-1|CAI16223.1| 172|Homo sapiens protein ( Human DNA seq... 58 7e-09 CR542080-1|CAG46877.1| 370|Homo sapiens TPST1 protein. 29 4.7 CR542060-1|CAG46857.1| 370|Homo sapiens TPST1 protein. 29 4.7 BC013188-1|AAH13188.1| 370|Homo sapiens tyrosylprotein sulfotra... 29 4.7 AF038009-1|AAC13552.1| 370|Homo sapiens tyrosylprotein sulfotra... 29 4.7 AB040880-1|BAA95971.1| 1721|Homo sapiens KIAA1447 protein protein. 29 6.2 >Z49148-1|CAA89008.1| 159|Homo sapiens ribosomal protein L29 protein. Length = 159 Score = 58.4 bits (135), Expect = 7e-09 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 57 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHES 149 MAKSKNHT HNQ+RK HRNGIKKPR R+ES Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYES 31 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +1 Query: 160 MDPKFLRNQRFCKKGNLKPAKQL 228 +DPKFLRN RF KK N K K++ Sbjct: 35 VDPKFLRNMRFAKKHNKKGLKKM 57 >U49083-1|AAC50647.1| 159|Homo sapiens HIP protein. Length = 159 Score = 58.4 bits (135), Expect = 7e-09 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 57 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHES 149 MAKSKNHT HNQ+RK HRNGIKKPR R+ES Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYES 31 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +1 Query: 160 MDPKFLRNQRFCKKGNLKPAKQL 228 +DPKFLRN RF KK N K K++ Sbjct: 35 VDPKFLRNMRFAKKHNKKGLKKM 57 >U10248-1|AAC50499.1| 159|Homo sapiens ribosomal protein L29 protein. Length = 159 Score = 58.4 bits (135), Expect = 7e-09 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 57 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHES 149 MAKSKNHT HNQ+RK HRNGIKKPR R+ES Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYES 31 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +1 Query: 160 MDPKFLRNQRFCKKGNLKPAKQL 228 +DPKFLRN RF KK N K K++ Sbjct: 35 VDPKFLRNMRFAKKHNKKGLKKM 57 >BC071909-1|AAH71909.1| 161|Homo sapiens ribosomal protein L29 protein. Length = 161 Score = 58.4 bits (135), Expect = 7e-09 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 57 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHES 149 MAKSKNHT HNQ+RK HRNGIKKPR R+ES Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYES 31 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +1 Query: 160 MDPKFLRNQRFCKKGNLKPAKQL 228 +DPKFLRN RF KK N K K++ Sbjct: 35 VDPKFLRNMRFAKKHNKKGLKKM 57 >BC071663-1|AAH71663.1| 159|Homo sapiens ribosomal protein L29 protein. Length = 159 Score = 58.4 bits (135), Expect = 7e-09 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 57 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHES 149 MAKSKNHT HNQ+RK HRNGIKKPR R+ES Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYES 31 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +1 Query: 160 MDPKFLRNQRFCKKGNLKPAKQL 228 +DPKFLRN RF KK N K K++ Sbjct: 35 VDPKFLRNMRFAKKHNKKGLKKM 57 >BC070481-1|AAH70481.1| 159|Homo sapiens ribosomal protein L29 protein. Length = 159 Score = 58.4 bits (135), Expect = 7e-09 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 57 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHES 149 MAKSKNHT HNQ+RK HRNGIKKPR R+ES Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYES 31 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +1 Query: 160 MDPKFLRNQRFCKKGNLKPAKQL 228 +DPKFLRN RF KK N K K++ Sbjct: 35 VDPKFLRNMRFAKKHNKKGLKKM 57 >BC070190-1|AAH70190.1| 159|Homo sapiens ribosomal protein L29 protein. Length = 159 Score = 58.4 bits (135), Expect = 7e-09 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 57 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHES 149 MAKSKNHT HNQ+RK HRNGIKKPR R+ES Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYES 31 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +1 Query: 160 MDPKFLRNQRFCKKGNLKPAKQL 228 +DPKFLRN RF KK N K K++ Sbjct: 35 VDPKFLRNMRFAKKHNKKGLKKM 57 >BC008926-1|AAH08926.1| 159|Homo sapiens ribosomal protein L29 protein. Length = 159 Score = 58.4 bits (135), Expect = 7e-09 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 57 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHES 149 MAKSKNHT HNQ+RK HRNGIKKPR R+ES Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYES 31 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +1 Query: 160 MDPKFLRNQRFCKKGNLKPAKQL 228 +DPKFLRN RF KK N K K++ Sbjct: 35 VDPKFLRNMRFAKKHNKKGLKKM 57 >AL450405-1|CAI16223.1| 172|Homo sapiens protein ( Human DNA sequence from clone RP11-632C17 on chromosome 6 Contains the gene for a novel protein similar to ribosomal protein L29 ). Length = 172 Score = 58.4 bits (135), Expect = 7e-09 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 57 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHES 149 MAKSKNHT HNQ+RK HRNGIKKPR R+ES Sbjct: 16 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYES 46 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +1 Query: 160 MDPKFLRNQRFCKKGNLKPAKQL 228 +DPKFLRN RF KK N K K++ Sbjct: 50 VDPKFLRNMRFAKKHNKKGLKKM 72 >CR542080-1|CAG46877.1| 370|Homo sapiens TPST1 protein. Length = 370 Score = 29.1 bits (62), Expect = 4.7 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Frame = +1 Query: 52 SKWQSQRIIQIITKTAKLTEMVSKSQGRPGTNPPL--RMDPKFLRNQRFCKKGNLK 213 SKW + ++ A + M++K P NPP + DPK + N R KG + Sbjct: 300 SKWVGKIPPDVLQDMAVIAPMLAKLGYDPYANPPNYGKPDPKIIENTRRVYKGEFQ 355 >CR542060-1|CAG46857.1| 370|Homo sapiens TPST1 protein. Length = 370 Score = 29.1 bits (62), Expect = 4.7 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Frame = +1 Query: 52 SKWQSQRIIQIITKTAKLTEMVSKSQGRPGTNPPL--RMDPKFLRNQRFCKKGNLK 213 SKW + ++ A + M++K P NPP + DPK + N R KG + Sbjct: 300 SKWVGKIPPDVLQDMAVIAPMLAKLGYDPYANPPNYGKPDPKIIENTRRVYKGEFQ 355 >BC013188-1|AAH13188.1| 370|Homo sapiens tyrosylprotein sulfotransferase 1 protein. Length = 370 Score = 29.1 bits (62), Expect = 4.7 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Frame = +1 Query: 52 SKWQSQRIIQIITKTAKLTEMVSKSQGRPGTNPPL--RMDPKFLRNQRFCKKGNLK 213 SKW + ++ A + M++K P NPP + DPK + N R KG + Sbjct: 300 SKWVGKIPPDVLQDMAVIAPMLAKLGYDPYANPPNYGKPDPKIIENTRRVYKGEFQ 355 >AF038009-1|AAC13552.1| 370|Homo sapiens tyrosylprotein sulfotransferase-1 protein. Length = 370 Score = 29.1 bits (62), Expect = 4.7 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Frame = +1 Query: 52 SKWQSQRIIQIITKTAKLTEMVSKSQGRPGTNPPL--RMDPKFLRNQRFCKKGNLK 213 SKW + ++ A + M++K P NPP + DPK + N R KG + Sbjct: 300 SKWVGKIPPDVLQDMAVIAPMLAKLGYDPYANPPNYGKPDPKIIENTRRVYKGEFQ 355 >AB040880-1|BAA95971.1| 1721|Homo sapiens KIAA1447 protein protein. Length = 1721 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 45 KLIKMAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTL 155 +L ++ + +H +R R G +PRK +H S+L Sbjct: 715 ELARLQRKHDHERDESSRSPARRGPGRPRKRKHSSSL 751 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 44,450,501 Number of Sequences: 237096 Number of extensions: 784885 Number of successful extensions: 2026 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1940 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2022 length of database: 76,859,062 effective HSP length: 81 effective length of database: 57,654,286 effective search space used: 2363825726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -