BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_C19 (654 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g74270.1 68414.m08601 60S ribosomal protein L35a (RPL35aC) si... 111 4e-25 At1g07070.1 68414.m00753 60S ribosomal protein L35a (RPL35aA) si... 111 4e-25 At1g41880.1 68414.m04836 60S ribosomal protein L35a (RPL35aB) id... 109 1e-24 At3g55750.1 68416.m06194 60S ribosomal protein L35a (RPL35aD) ri... 109 2e-24 At5g53660.1 68418.m06665 expressed protein 31 0.88 At4g11860.1 68417.m01887 expressed protein contains Pfam domain ... 29 2.0 At4g21130.1 68417.m03055 transducin family protein / WD-40 repea... 28 6.2 At3g05180.1 68416.m00565 GDSL-motif lipase/hydrolase family prot... 27 8.2 >At1g74270.1 68414.m08601 60S ribosomal protein L35a (RPL35aC) similar to ribosomal protein L33B GB:NP_014877 from [Saccharomyces cerevisiae] Length = 112 Score = 111 bits (267), Expect = 4e-25 Identities = 52/110 (47%), Positives = 69/110 (62%) Frame = +2 Query: 227 RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGKHCVYVYRAKKRTPIPGGP 406 RLY + GYKR NQ+ NT+L+++EG + + +Y GK Y+Y+AK + Sbjct: 11 RLYVRGTILGYKRSKSNQYPNTSLVQIEGVNTQEEVNWYKGKRMAYIYKAKTKK------ 64 Query: 407 RGKKTKLRAIWGKVTRPHGNSGSVRAKFKSNLPAQAMGHXIRVMLYPSRI 556 + R IWGKVTRPHGNSG VRAKF SNLP ++MG +RV +YPS I Sbjct: 65 --NGSHYRCIWGKVTRPHGNSGVVRAKFTSNLPPKSMGSRVRVFMYPSNI 112 >At1g07070.1 68414.m00753 60S ribosomal protein L35a (RPL35aA) similar to ribosomal protein L35a GI:57118 from [Rattus norvegicus] Length = 112 Score = 111 bits (267), Expect = 4e-25 Identities = 53/110 (48%), Positives = 68/110 (61%) Frame = +2 Query: 227 RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGKHCVYVYRAKKRTPIPGGP 406 RLY + GYKR NQ+ NT+L++VEG + +Y GK Y+Y+AK + Sbjct: 11 RLYVRGTILGYKRSKSNQYPNTSLVQVEGVNTTEEVSWYKGKRMAYIYKAKTKK------ 64 Query: 407 RGKKTKLRAIWGKVTRPHGNSGSVRAKFKSNLPAQAMGHXIRVMLYPSRI 556 + R IWGKVTRPHGNSG VRAKF SNLP ++MG +RV +YPS I Sbjct: 65 --NGSHYRCIWGKVTRPHGNSGVVRAKFTSNLPPKSMGSRVRVFMYPSNI 112 >At1g41880.1 68414.m04836 60S ribosomal protein L35a (RPL35aB) identical to GB:CAB81600 from [Arabidopsis thaliana] Length = 111 Score = 109 bits (263), Expect = 1e-24 Identities = 51/110 (46%), Positives = 69/110 (62%) Frame = +2 Query: 227 RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGKHCVYVYRAKKRTPIPGGP 406 RLY + GYKR NQ+ NT+L+++EG + + +Y GK Y+Y+AK + Sbjct: 10 RLYVRGTVLGYKRSKSNQYPNTSLIQIEGVNTQEEVNWYKGKRLAYIYKAKTKK------ 63 Query: 407 RGKKTKLRAIWGKVTRPHGNSGSVRAKFKSNLPAQAMGHXIRVMLYPSRI 556 + R IWGKVTRPHGNSG VR+KF SNLP ++MG +RV +YPS I Sbjct: 64 --NGSHYRCIWGKVTRPHGNSGVVRSKFTSNLPPKSMGARVRVFMYPSNI 111 >At3g55750.1 68416.m06194 60S ribosomal protein L35a (RPL35aD) ribosomal protein L35a.e.c15, Saccharomyces cerevisiae, PIR:S44069 Length = 111 Score = 109 bits (262), Expect = 2e-24 Identities = 51/110 (46%), Positives = 69/110 (62%) Frame = +2 Query: 227 RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGKHCVYVYRAKKRTPIPGGP 406 RLY + GYKR NQ+ NT+L+++EG + + +Y GK Y+Y+AK + Sbjct: 10 RLYVRGTVLGYKRSKSNQYPNTSLVQIEGVNTQEEVNWYKGKRLAYIYKAKTKK------ 63 Query: 407 RGKKTKLRAIWGKVTRPHGNSGSVRAKFKSNLPAQAMGHXIRVMLYPSRI 556 + R IWGKVTRPHGNSG VR+KF SNLP ++MG +RV +YPS I Sbjct: 64 --NGSHYRCIWGKVTRPHGNSGVVRSKFTSNLPPKSMGARVRVFMYPSNI 111 >At5g53660.1 68418.m06665 expressed protein Length = 365 Score = 30.7 bits (66), Expect = 0.88 Identities = 21/79 (26%), Positives = 37/79 (46%), Gaps = 1/79 (1%) Frame = +2 Query: 407 RGKKTKLRAIWGKVTRPHGNSGSVRAKFKSNLPAQAMGHXIR-VMLYPSRI*XPSANYKN 583 RG+ + + +RP+ N GSV+ + LP + I+ L P + +NY++ Sbjct: 140 RGRPRSRKHVEPPYSRPNNNGGSVKNRDLKKLPQKLSSSSIKDKTLEPMEVSSSISNYRD 199 Query: 584 KNKIQKKTNSVSLTSQFNK 640 +K T ++ T Q NK Sbjct: 200 SRGSEKFT-VLATTEQENK 217 >At4g11860.1 68417.m01887 expressed protein contains Pfam domain PF04424: Protein of unknown function (DUF544) Length = 682 Score = 29.5 bits (63), Expect = 2.0 Identities = 14/62 (22%), Positives = 29/62 (46%) Frame = +2 Query: 308 EGAKDRNDAVFYAGKHCVYVYRAKKRTPIPGGPRGKKTKLRAIWGKVTRPHGNSGSVRAK 487 EG K+R VF+ H +++ + + +G + +W K+ +G++ + A Sbjct: 508 EGLKERELCVFFRNNHFCTMFKYEGELYLLATDQGYLNQPDLVWEKLNEVNGDTAFMTAT 567 Query: 488 FK 493 FK Sbjct: 568 FK 569 >At4g21130.1 68417.m03055 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); some similarity to a group of proteins with homology to mammalian apoptosis regulators identified in zebrafish (PUBMED:10917738)Apaf-1(gi:7677507) Length = 537 Score = 27.9 bits (59), Expect = 6.2 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = -3 Query: 538 HHSYXVS-HSLGREVRLELGSDTARVAMWAGHLAPDSTQLGFFATGTSGNWCPLLSS 371 H S +S +LGRE L +G D G + P+ST+L + A+ ++ C ++S Sbjct: 304 HQSELLSIDALGRERVLSVGRDRTMQLYKVGIVVPESTRLIYRASESNFECCCFVNS 360 >At3g05180.1 68416.m00565 GDSL-motif lipase/hydrolase family protein similar to early nodulin ENOD8 [Medicago sativa] GI:304037, elicitor-induced glycoprotein iEP4 [Daucus carota] GI:1911765, lanatoside 15'-O-acetylesterase [Digitalis lanata] GI:3688284; contains InterPro Entry IPR001087 Lipolytic enzyme, G-D-S-L family Length = 379 Score = 27.5 bits (58), Expect = 8.2 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -3 Query: 481 SDTARVAMWAGHLAPDSTQLGFFATGTSGNWC 386 SDT ++ G L S ++ FF + TSG +C Sbjct: 45 SDTGELSSGLGFLPQPSYEITFFRSPTSGRFC 76 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,852,498 Number of Sequences: 28952 Number of extensions: 233985 Number of successful extensions: 602 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 570 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 598 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -