BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_C17 (653 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1757 - 39678181-39678325,39678472-39678626,39678731-396788... 90 2e-18 07_01_0389 - 2915191-2915604,2915696-2915752,2915867-2915922,291... 27 9.9 >01_06_1757 - 39678181-39678325,39678472-39678626,39678731-39678898, 39679532-39679723,39679821-39680000,39680099-39680266 Length = 335 Score = 89.8 bits (213), Expect = 2e-18 Identities = 44/105 (41%), Positives = 64/105 (60%) Frame = +3 Query: 339 PQAMKLLKEMNVNVQQVSQLVDNMLVRVKNGELSTDKGLTFLEMKYQMLLSYLINLTYIV 518 P+ + LKEM + V+ V + +VK +L T G+ +LE K+ +LLSY ++ Y + Sbjct: 30 PKLLAALKEMKEGLDLVTGKVKALTRKVKKNQLPTADGIGYLEAKHHLLLSYCQDIVYYL 89 Query: 519 LRKCSGERIESDPSIDRLIEIRTVLEKIRPIDSKLKYQIDKLVKS 653 LRK G +E P + L+EIR LEKIRPID K++YQI KL + Sbjct: 90 LRKAKGLSVEGHPVVRSLVEIRLFLEKIRPIDKKMEYQIQKLTNA 134 >07_01_0389 - 2915191-2915604,2915696-2915752,2915867-2915922, 2916053-2916113,2916243-2916365,2916505-2916537, 2916617-2916709,2916839-2916934,2917025-2917203, 2917344-2917530,2918051-2918184,2918311-2918518, 2918598-2918633,2918785-2919241,2919633-2919736, 2920489-2920569,2920646-2920697,2920837-2920876, 2920991-2921085,2921241-2921383,2921899-2922006, 2922120-2922221,2922302-2922348,2922425-2922554, 2923173-2923304,2923404-2923616,2923709-2923963, 2924053-2924799 Length = 1460 Score = 27.5 bits (58), Expect = 9.9 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +3 Query: 261 ISIINYRSTIL-INMVQACEETEQPNIPQAMKLLKEMNVN 377 I + STI +N C ++QPN +A++LLK M VN Sbjct: 556 IGALRIVSTIADVNASMNCSSSQQPNYDEALELLK-MAVN 594 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,843,516 Number of Sequences: 37544 Number of extensions: 241025 Number of successful extensions: 523 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 516 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 523 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1632177336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -