BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_C13 (652 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712903-1|CAN84642.1| 148|Tribolium castaneum hypothetical pro... 23 1.6 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 23 2.9 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 23 2.9 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 21 8.8 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 21 8.8 >AM712903-1|CAN84642.1| 148|Tribolium castaneum hypothetical protein protein. Length = 148 Score = 23.4 bits (48), Expect = 1.6 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Frame = -2 Query: 153 LLLNIDGALTSYQSLRVNGSTIFFV---NTFFTALRQALYFSRPPCSNTNLRKA 1 ++++ G + + STI NT F+ + + F + CSN+ LRKA Sbjct: 17 IIISCPGGFVMEDANNLTQSTILTTCESNTDFSFGSKTIDFRKIQCSNSPLRKA 70 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 22.6 bits (46), Expect = 2.9 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +1 Query: 373 GWLKNGRLSS 402 GWLK G+LSS Sbjct: 124 GWLKKGKLSS 133 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 22.6 bits (46), Expect = 2.9 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = -2 Query: 483 SRSPYW*NQCRRHVERIHRLSSHQC 409 + P+ ++CR R H L H+C Sbjct: 243 NEKPFECDKCRGRFRRRHHLVHHKC 267 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 21.0 bits (42), Expect = 8.8 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = -1 Query: 493 LRWLKESLLVKPMQKTRRTYPSVVFTSMLASMR 395 ++W K++ L R+T P+ V T+ +R Sbjct: 286 MKWKKDNKLPNTKNVRRKTNPAGVTTTTKGKVR 318 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 21.0 bits (42), Expect = 8.8 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = -1 Query: 493 LRWLKESLLVKPMQKTRRTYPSVVFTSMLASMR 395 ++W K++ L R+T P+ V T+ +R Sbjct: 286 MKWKKDNKLPNTKNVRRKTNPAGVTTTTKGKVR 318 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,292 Number of Sequences: 336 Number of extensions: 3302 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -