BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_C13 (652 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37698| Best HMM Match : Ribosomal_S3Ae (HMM E-Value=5e-21) 126 2e-29 SB_42790| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_21643| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_53398| Best HMM Match : RVT_1 (HMM E-Value=7.8e-12) 29 3.3 SB_33652| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_37029| Best HMM Match : 7tm_1 (HMM E-Value=4.2039e-45) 29 3.3 SB_50701| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_45038| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_7051| Best HMM Match : RVT_1 (HMM E-Value=0.064) 28 7.6 >SB_37698| Best HMM Match : Ribosomal_S3Ae (HMM E-Value=5e-21) Length = 147 Score = 126 bits (304), Expect = 2e-29 Identities = 57/86 (66%), Positives = 72/86 (83%) Frame = +3 Query: 393 TLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYAQHTQVRAIXKKMCEIITRDVTN 572 TLIEA +DVKTTDGY+LR+FCIGFT + +KT YA+HTQ++AI KKM +IITR+V+ Sbjct: 2 TLIEAAVDVKTTDGYLLRMFCIGFTKRRQNQIKKTAYAKHTQIKAIRKKMVDIITREVST 61 Query: 573 SELREVVNKLIPDSIAKDIEKACHGI 650 ++L+EVVNKLIPDSI KDIEK+C I Sbjct: 62 NDLKEVVNKLIPDSIGKDIEKSCQSI 87 >SB_42790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 552 Score = 29.9 bits (64), Expect = 1.9 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 3/59 (5%) Frame = -2 Query: 225 LFPSILPKQFS-LXWVRLTSVVP--TCLLLNIDGALTSYQSLRVNGSTIFFVNTFFTAL 58 L P +L Q + L W+ + +V+ TCL + I +L +QS +++ F +N F A+ Sbjct: 285 LVPLVLIHQLTVLAWLSMLAVLSLITCLFIIIGYSLQEWQSWKIHNIPDFDINNFPVAI 343 >SB_21643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1974 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = +3 Query: 225 VFEVSLADLQADTDAERSFRKFRLIAEYVQ 314 +F + +D+QA+++ FR+F L+ EYV+ Sbjct: 1176 IFNNTFSDVQANSNQIWKFRRFELVMEYVE 1205 >SB_53398| Best HMM Match : RVT_1 (HMM E-Value=7.8e-12) Length = 924 Score = 29.1 bits (62), Expect = 3.3 Identities = 25/88 (28%), Positives = 41/88 (46%) Frame = -1 Query: 427 VVFTSMLASMRVCHFLTIHLSLSVVRSMPWKLQSTLRPCTYSAINLNLRKDLSASVSACR 248 V T + + + C F T+ SL R + ++R + N L +++A R Sbjct: 101 VFVTDLRSKAKTCEFGTLQDSLIKDRIVCGIDSDSIR----ERLLRNTELTLDTAINAVR 156 Query: 247 SARETSKTLPFNPSEAIFVALGTVDKRG 164 +A ETSKT N + +A G ++KRG Sbjct: 157 AA-ETSKTQIENLKDGASLAAGALNKRG 183 >SB_33652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 29.1 bits (62), Expect = 3.3 Identities = 19/68 (27%), Positives = 33/68 (48%), Gaps = 2/68 (2%) Frame = -2 Query: 267 RQCQLVDQPGKLRKLFPSILPKQFSLXWVRLTSVVPTCLLLNIDGALTSYQSLRVNGSTI 88 RQ ++ QP ++R + F + V L + +P ++LN+D L Q ST+ Sbjct: 211 RQRKIKPQPNRIRPRDKELGVALFIVTVVSLLTWLPDAVVLNLDSVLAPAQYKHAVRSTL 270 Query: 87 F--FVNTF 70 F + N+F Sbjct: 271 FLRYSNSF 278 >SB_37029| Best HMM Match : 7tm_1 (HMM E-Value=4.2039e-45) Length = 1102 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/57 (26%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = -1 Query: 412 MLASMRVCHFLTIHLSLSVVRSMPWKLQSTLRPCTYSAINLNLRKDLSA--SVSACR 248 ++ SM +C ++ + +SL R + + +L PC Y ++++L + + S+S CR Sbjct: 948 VVMSMSLCRYVHVVMSLCPCRYVHVVMSMSLCPCRYVVMSMSLCRYIHVVMSMSLCR 1004 >SB_50701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 28.7 bits (61), Expect = 4.3 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 89 IVDPFTRKDWYDVKAPSMFSKRQ 157 +V+P+ KDW D SMFS RQ Sbjct: 98 LVEPWRWKDWEDFTQSSMFSGRQ 120 >SB_45038| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 561 Score = 28.7 bits (61), Expect = 4.3 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 286 LRKDLSASVSACRSARETSKTLPFNPSEAIFV 191 LRK L S + RE + L FNP E+ +V Sbjct: 302 LRKQLIDMASVAKDLREIDELLKFNPDESAYV 333 >SB_7051| Best HMM Match : RVT_1 (HMM E-Value=0.064) Length = 756 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 47 RACRRAVKKVLTKKIVDPFTRKDWYDVK 130 R C+R+ + KK+ D TRK W +VK Sbjct: 7 RTCKRSFYQSKVKKLKDTNTRKWWREVK 34 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,092,119 Number of Sequences: 59808 Number of extensions: 434280 Number of successful extensions: 1259 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1149 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1255 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -