BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_C12 (510 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 24 3.4 AY187043-1|AAO39757.1| 171|Anopheles gambiae putative antennal ... 23 7.9 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 23.8 bits (49), Expect = 3.4 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = -3 Query: 214 PGTGRRQSVQATFDSLGQ-RSHTDSLRPVLSAQ 119 PGTG R S+Q D + Q RS + PV Q Sbjct: 24 PGTGDRASIQRLEDEMVQERSFSQRALPVPRTQ 56 >AY187043-1|AAO39757.1| 171|Anopheles gambiae putative antennal carrier protein AP-1 protein. Length = 171 Score = 22.6 bits (46), Expect = 7.9 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +3 Query: 21 IXDTTKCLREDVVVPRERNSVSPWVSQLGAVINCADNTGR 140 I DT KC E +NS V+++ C D G+ Sbjct: 56 ICDTLKCPAESFKCVIVKNSTKDDVNKVQVTRECLDPAGK 95 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 537,312 Number of Sequences: 2352 Number of extensions: 11731 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46091631 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -