BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_C07 (653 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g16640.1 68416.m02127 translationally controlled tumor family... 80 1e-15 At3g05540.1 68416.m00607 translationally controlled tumor family... 77 1e-14 At2g17050.1 68415.m01968 disease resistance protein (TIR-NBS-LRR... 33 0.17 At4g29060.1 68417.m04157 elongation factor Ts family protein sim... 28 4.7 At4g12570.1 68417.m01983 ubiquitin-protein ligase, putative simi... 28 4.7 At3g59660.1 68416.m06656 C2 domain-containing protein / GRAM dom... 28 6.2 At5g49030.1 68418.m06067 tRNA synthetase class I (I, L, M and V)... 27 8.2 >At3g16640.1 68416.m02127 translationally controlled tumor family protein similar to translationally controlled tumor protein GB:AAD10032 from [Hevea brasiliensis] Length = 168 Score = 80.2 bits (189), Expect = 1e-15 Identities = 53/140 (37%), Positives = 70/140 (50%), Gaps = 2/140 (1%) Frame = +1 Query: 184 W*REHRADIQIEGFNPSAEEA--DEGTDSAVESGVDIXLNHRLVETYAFGDKKSYTLYLK 357 W D+ I G NPSAEE DEG D + + VDI RL E + DKK + Y+K Sbjct: 35 WVTVGAVDVNI-GANPSAEEGGEDEGVDDSTQKVVDIVDTFRLQEQPTY-DKKGFIAYIK 92 Query: 358 DYMKKLVAKLEXKAPDQVEVFKTNMNKVMKDILGRFKELQFFTGESMDCDGMVAMMEYXD 537 Y+K L KL + DQ VFK + K +L R + QFF GE M D + Y Sbjct: 93 KYIKLLTPKLSEE--DQA-VFKKGIEGATKFLLPRLSDFQFFVGEGMHDDSTLVFAYYK- 148 Query: 538 FDGTQIPIMMFFKHGLQXXK 597 +G+ P ++F HGL+ K Sbjct: 149 -EGSTNPTFLYFAHGLKEVK 167 >At3g05540.1 68416.m00607 translationally controlled tumor family protein similar to translationally controlled tumor protein GB:AAD10032 from [Hevea brasiliensis] Length = 156 Score = 76.6 bits (180), Expect = 1e-14 Identities = 46/132 (34%), Positives = 72/132 (54%), Gaps = 3/132 (2%) Frame = +1 Query: 211 QIEGFNPSAEEA--DEGTDSAVESGVDIXLNHRLVETYAFGDKKSYTLYLKDYMKKLVAK 384 ++EG NPS EE DEG D VDI RL E +F DKK + +++K Y+K+L K Sbjct: 30 EVEGKNPSGEEGGEDEGVDDQAVKVVDIIDTFRLQEQPSF-DKKQFVMFMKRYIKQLSPK 88 Query: 385 LEXKAPDQVEVFKTNMNKVMKDILGRFKELQFFTGESMDC-DGMVAMMEYXDFDGTQIPI 561 L+ + E+FK ++ K ++ + K+ QFF GESM+ +G + Y +G P Sbjct: 89 LDS---ENQELFKKHIESATKFLMSKLKDFQFFVGESMEGEEGSLVFAYYR--EGATDPT 143 Query: 562 MMFFKHGLQXXK 597 ++ +GL+ K Sbjct: 144 FLYLAYGLKEIK 155 >At2g17050.1 68415.m01968 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1355 Score = 33.1 bits (72), Expect = 0.17 Identities = 25/91 (27%), Positives = 43/91 (47%), Gaps = 8/91 (8%) Frame = +1 Query: 253 GTDSAVESGVDIXLNHRLVETYAFGDKKSYTLYLK-------DYMKKLVAKLEXKAPDQV 411 G D +SG++ + + Y G+ + +LY + D M+ + KL P + Sbjct: 184 GIDWRKQSGLETLAPYYISVKYFSGNPLALSLYEEMLSHMKSDKMEVKLLKLNHPPPQIM 243 Query: 412 EVFKTNMNKVMKDILGRFKELQ-FFTGESMD 501 EVFK+N N + ++ F ++ FF GE D Sbjct: 244 EVFKSNYNALNENEKSMFLDIACFFRGEKAD 274 >At4g29060.1 68417.m04157 elongation factor Ts family protein similar to SP|P35019 Elongation factor Ts (EF-Ts) {Galdieria sulphuraria}; contains Pfam profiles PF00627: UBA/TS-N domain, PF00889: Elongation factor TS, PF00575: S1 RNA binding domain Length = 953 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +1 Query: 217 EGFNPSAEEADEGTDSAVESG 279 EGF P+AEEAD+G S + G Sbjct: 272 EGFLPTAEEADDGIGSMMMGG 292 >At4g12570.1 68417.m01983 ubiquitin-protein ligase, putative similar to SP|P39940 Ubiquitin--protein ligase RSP5 (EC 6.3.2.-) {Saccharomyces cerevisiae}; contains Pfam profiles PF00240: Ubiquitin family, PF00632: HECT-domain (ubiquitin-transferase) Length = 873 Score = 28.3 bits (60), Expect = 4.7 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = -3 Query: 318 VCFD*PVVQXYVNSALDGRVRALVSLFSRRIKTLDLDISPVLSS 187 V F P+V ++AL+ +R L LF + T+DL + V SS Sbjct: 369 VAFPIPIVLPMQSTALEAEIRHLHRLFGSLLTTMDLCMCRVESS 412 >At3g59660.1 68416.m06656 C2 domain-containing protein / GRAM domain-containing protein low similarity to GLUT4 vesicle protein [Rattus norvegicus] GI:4193489; contains Pfam profiles PF00168: C2 domain, PF02893: GRAM domain Length = 594 Score = 27.9 bits (59), Expect = 6.2 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -2 Query: 553 FAYHQSLYIPSWQPC-HHNPWTPQ*RTEVP 467 F YH +Y+ +W C H N ++ Q + VP Sbjct: 255 FLYHGRMYVSAWHICFHSNVFSKQMKVVVP 284 >At5g49030.1 68418.m06067 tRNA synthetase class I (I, L, M and V) family protein similar to SP|P41972 Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA ligase) (IleRS) {Staphylococcus aureus}; contains Pfam profile PF00133: tRNA synthetases class I (I, L, M and V) Length = 1093 Score = 27.5 bits (58), Expect = 8.2 Identities = 12/31 (38%), Positives = 20/31 (64%), Gaps = 3/31 (9%) Frame = +1 Query: 430 MNKVMKDILGRFKELQFFTGE---SMDCDGM 513 +NK++KDI+ R+K LQ + + DC G+ Sbjct: 167 LNKILKDIINRYKLLQNYKVQYVPGWDCHGL 197 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,301,041 Number of Sequences: 28952 Number of extensions: 226345 Number of successful extensions: 599 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 589 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 594 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -