BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_C04 (506 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC015968-1|AAH15968.1| 79|Homo sapiens chromosome 11 open read... 92 1e-18 BC002750-1|AAH02750.1| 79|Homo sapiens chromosome 11 open read... 92 1e-18 AF086763-1|AAF28401.1| 79|Homo sapiens C11orf10 protein. 92 1e-18 >BC015968-1|AAH15968.1| 79|Homo sapiens chromosome 11 open reading frame 10 protein. Length = 79 Score = 91.9 bits (218), Expect = 1e-18 Identities = 43/79 (54%), Positives = 52/79 (65%) Frame = -2 Query: 415 LEIESMIRYTSPINPAVFPHXXXXXXXXXXXXXXWFFVYEVTSTKASRDMFKELLLSLVA 236 +E+E+M RYTSP+NPAVFPH WFFVYEVTSTK +RD++KELL+SLVA Sbjct: 1 MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA 60 Query: 235 AXXXXXXXXXXXLWVGIYV 179 + LWVGIYV Sbjct: 61 SLFMGFGVLFLLLWVGIYV 79 >BC002750-1|AAH02750.1| 79|Homo sapiens chromosome 11 open reading frame 10 protein. Length = 79 Score = 91.9 bits (218), Expect = 1e-18 Identities = 43/79 (54%), Positives = 52/79 (65%) Frame = -2 Query: 415 LEIESMIRYTSPINPAVFPHXXXXXXXXXXXXXXWFFVYEVTSTKASRDMFKELLLSLVA 236 +E+E+M RYTSP+NPAVFPH WFFVYEVTSTK +RD++KELL+SLVA Sbjct: 1 MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA 60 Query: 235 AXXXXXXXXXXXLWVGIYV 179 + LWVGIYV Sbjct: 61 SLFMGFGVLFLLLWVGIYV 79 >AF086763-1|AAF28401.1| 79|Homo sapiens C11orf10 protein. Length = 79 Score = 91.9 bits (218), Expect = 1e-18 Identities = 43/79 (54%), Positives = 52/79 (65%) Frame = -2 Query: 415 LEIESMIRYTSPINPAVFPHXXXXXXXXXXXXXXWFFVYEVTSTKASRDMFKELLLSLVA 236 +E+E+M RYTSP+NPAVFPH WFFVYEVTSTK +RD++KELL+SLVA Sbjct: 1 MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA 60 Query: 235 AXXXXXXXXXXXLWVGIYV 179 + LWVGIYV Sbjct: 61 SLFMGFGVLFLLLWVGIYV 79 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 57,656,863 Number of Sequences: 237096 Number of extensions: 1021037 Number of successful extensions: 1469 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1455 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1469 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4706589866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -