BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_C03 (648 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50471-1|AAA93474.1| 135|Anopheles gambiae protein ( Anopheles ... 151 2e-38 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 26 0.89 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 24 3.6 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 24 4.8 AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 23 6.3 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 23 6.3 AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript... 23 6.3 AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F rec... 23 8.3 >U50471-1|AAA93474.1| 135|Anopheles gambiae protein ( Anopheles gambiae putativeribosomal protein S8 mRNA, complete cds. ). Length = 135 Score = 151 bits (366), Expect = 2e-38 Identities = 68/110 (61%), Positives = 89/110 (80%) Frame = +2 Query: 305 RPLFKNAIVVVDATPFRQWYESHYTLPLGRKKGAKLTEAEEAIINKKRSQKTARKYLARQ 484 + L KNAI+V+DA+PFRQWYESHY LPLG+K+ +L EE +++KKR++ RKY+ RQ Sbjct: 23 KTLVKNAIIVIDASPFRQWYESHYLLPLGKKR--ELKAGEEDVLSKKRTKSNLRKYVKRQ 80 Query: 485 RLAKVEGALXEQFHTGRLLACVASRPGQCGRXDGYILQXKELEFYLTKIK 634 + AK++ A+ EQF+ GRLLAC++SRPGQ GR DGYIL+ KELEFYL KIK Sbjct: 81 KNAKIDPAVEEQFNAGRLLACISSRPGQVGRADGYILEGKELEFYLKKIK 130 Score = 48.8 bits (111), Expect = 1e-07 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = +1 Query: 244 RKTRIIDVVYNASNNELVRTKTLVQ 318 RK RIIDVVYNASNNEL+RTKTLV+ Sbjct: 3 RKARIIDVVYNASNNELIRTKTLVK 27 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 26.2 bits (55), Expect = 0.89 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +2 Query: 152 PLRFVHVVEILSTVRCVWTP--VTSLGDRNVQLAK 250 PLR VH +LS V C+ +P V+ L R + L K Sbjct: 860 PLRDVHGTVVLSCVNCIKSPKAVSVLNSRWIPLNK 894 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 24.2 bits (50), Expect = 3.6 Identities = 11/40 (27%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +3 Query: 60 PPAGKRAPIRKKRKYELGRPAANTRLGPQRIHSXSF-TWW 176 PPA +R+ + + RP + + P+R F +WW Sbjct: 274 PPARRRSRSTRPTSWPRSRPTSKPKRLPRRRRPFFFSSWW 313 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -1 Query: 360 HCLNGVASTTTIAFLNKGLCTHQFIVRCI 274 HCL VA LN+ + HQ ++ C+ Sbjct: 247 HCLARVAQDRAEKELNEIISMHQRVLNCV 275 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 23.4 bits (48), Expect = 6.3 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +2 Query: 314 FKNAIVVVDATPFRQWYESHYTLP 385 FK+ D TP W+ SH T P Sbjct: 35 FKDESFGHDQTPAGSWWSSHLTEP 58 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 23.4 bits (48), Expect = 6.3 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +2 Query: 314 FKNAIVVVDATPFRQWYESHYTLP 385 FK+ D TP W+ SH T P Sbjct: 35 FKDESFGHDQTPAGSWWSSHLTEP 58 >AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase protein. Length = 1049 Score = 23.4 bits (48), Expect = 6.3 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -2 Query: 245 RVEHSDPQEKLPVSRRSARYLVFPPRERXGVDTLRTEP 132 +V+ S+P E+ PV +S +FP ++T T+P Sbjct: 355 KVKSSEPVEQCPVKLKSIIETLFPTHPT--INTPETDP 390 >AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F receptor protein. Length = 425 Score = 23.0 bits (47), Expect = 8.3 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -1 Query: 369 DSYHCLNGVASTTTIAFLNKGLCTHQFIVRCIIH 268 DS + +A T I ++ L + FI+R +IH Sbjct: 151 DSLQLMGAIAILTGIWIISIVLASPMFIIRQLIH 184 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 670,572 Number of Sequences: 2352 Number of extensions: 13412 Number of successful extensions: 21 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -