BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_B20 (641 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 24 1.4 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 24 1.4 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 7.7 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 21 7.7 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 23.8 bits (49), Expect = 1.4 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +3 Query: 438 LNKAGKFPGLLSHQE 482 LNK GK P L++H+E Sbjct: 573 LNKIGKNPNLVAHRE 587 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 23.8 bits (49), Expect = 1.4 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +3 Query: 438 LNKAGKFPGLLSHQE 482 LNK GK P L++H+E Sbjct: 541 LNKIGKNPNLVAHRE 555 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 7.7 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = -3 Query: 294 KVLASSQCCW 265 K +A QCCW Sbjct: 598 KYVAGEQCCW 607 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 21.4 bits (43), Expect = 7.7 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -2 Query: 568 WPTXTERHNTXFIWNLMVPLTSSXLCVMDSWW 473 +PT + + +++N PL+S+ L + W Sbjct: 376 YPTFNQTNVDQYLYNQTGPLSSTGLAQVTGIW 407 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,678 Number of Sequences: 438 Number of extensions: 3257 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19315974 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -