BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_B19 (612 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0628 - 25643006-25643123,25643314-25643471,25643559-256436... 88 4e-18 01_05_0142 - 18564697-18564792,18564824-18564928,18565606-185656... 33 0.24 09_02_0062 - 3742857-3743045,3744641-3744916,3745933-3745992,374... 29 2.9 09_04_0741 - 19852339-19852497,19853185-19853246,19853352-198534... 28 6.7 05_01_0168 + 1162459-1162785,1163609-1163719,1163853-1163969,116... 28 6.7 01_05_0078 + 17931998-17932062,17933320-17933416,17933506-179336... 28 6.7 12_02_0844 - 23609783-23609926,23610014-23610331,23610771-236109... 27 8.9 06_01_1128 + 9300144-9300273,9300340-9300472,9300585-9300656,930... 27 8.9 >11_06_0628 - 25643006-25643123,25643314-25643471,25643559-25643687, 25644378-25644451,25644771-25644798 Length = 168 Score = 88.2 bits (209), Expect = 4e-18 Identities = 56/140 (40%), Positives = 74/140 (52%), Gaps = 2/140 (1%) Frame = +2 Query: 182 W*REHRADIQIEGFNPSAEEA--DEGTDSAVESGVDIXLNHRLXETYAFGDKKSYTLYLK 355 W + D+ I G NPSAE DEG D VDI RL E F DKK + ++K Sbjct: 35 WVVQGAIDVDI-GANPSAEGGGDDEGVDDQAVKVVDIVDTFRLQEQPPF-DKKQFVTFMK 92 Query: 356 DYMKKLVXKLEEKAPDQVEVFKTNMNKVMKDILGRFKELQFFTGESMDCDGMVAMMEYXD 535 Y+K L KL+ ++ E FK N+ K +LG+ K+LQFF GESM DG + Y Sbjct: 93 RYIKNLSAKLDA---EKQEEFKKNIEGATKYLLGKLKDLQFFVGESMHDDGGLVFAYYK- 148 Query: 536 FDGTQIPIMMFFKHGLQQEK 595 DG P ++F HGL++ K Sbjct: 149 -DGATDPTFLYFSHGLKEVK 167 Score = 35.9 bits (79), Expect = 0.025 Identities = 13/38 (34%), Positives = 28/38 (73%), Gaps = 1/38 (2%) Frame = +1 Query: 82 MKIYKDIITGDEMFSDTYKMKLVDE-VIYEVTGRLVTR 192 M +Y+D++TGDE+ SD++ + ++ +++EV G+ V + Sbjct: 1 MLVYQDLLTGDELLSDSFPYREIENGILWEVDGKWVVQ 38 >01_05_0142 - 18564697-18564792,18564824-18564928,18565606-18565678, 18566262-18567637 Length = 549 Score = 32.7 bits (71), Expect = 0.24 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 4/49 (8%) Frame = -3 Query: 526 FHHGNHAITIHGLPSKEL----KFLKPAEDVFHYFVHVCFKYFNLVRRL 392 FHH H ++ PSK+L ++L+ FH F ++C++Y + R+L Sbjct: 245 FHHMLHLFQMYLKPSKKLVEGSQYLERGR-YFHSFANICYRYLKIGRKL 292 >09_02_0062 - 3742857-3743045,3744641-3744916,3745933-3745992, 3746554-3748102,3748183-3748418 Length = 769 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +2 Query: 191 EHRADIQIEGFNPSAEEADEGTDSAVESGVDIXLNHRLXETYAFGDKK 334 + + + I N S EE +E ++A VD+ LN E +G+KK Sbjct: 706 QEKFSVSINYENASLEEVEEA-EAAARYAVDVHLNRPTLELKRYGEKK 752 >09_04_0741 - 19852339-19852497,19853185-19853246,19853352-19853415, 19853561-19853614,19853744-19853890,19854460-19854564, 19854651-19854794,19854987-19855093,19855613-19855712, 19855804-19855833,19856492-19856608,19856705-19856828, 19857143-19857189,19857272-19857400,19857777-19857852, 19858446-19858543,19858630-19858671,19858811-19859044 Length = 612 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -2 Query: 551 FAYHQSLYIPSWQPC-HHNPWTPQ*RTEVP 465 F YH +Y+ SW C H N ++ Q + +P Sbjct: 264 FLYHGRMYVSSWHICFHSNVFSKQIKVMLP 293 >05_01_0168 + 1162459-1162785,1163609-1163719,1163853-1163969, 1164082-1164240,1164663-1164797,1165116-1165268, 1165358-1165479,1165599-1166541,1166677-1166728, 1166873-1167963,1168058-1168384,1168479-1168559, 1168649-1168717,1168809-1168937,1169038-1169121, 1169210-1169275 Length = 1321 Score = 27.9 bits (59), Expect = 6.7 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 2/61 (3%) Frame = +2 Query: 323 GDKKSYTL-YLKDYMKKLVXK-LEEKAPDQVEVFKTNMNKVMKDILGRFKELQFFTGESM 496 G +K TL L++Y+ +V L+ +Q+E FK +NKV K L+ F+ + M Sbjct: 1140 GSEKMVTLDNLEEYVSSIVDATLKSGISNQIEAFKAGINKVF-----ALKTLRLFSEDEM 1194 Query: 497 D 499 + Sbjct: 1195 E 1195 >01_05_0078 + 17931998-17932062,17933320-17933416,17933506-17933601, 17933957-17933988,17935143-17935595,17935831-17935975, 17936058-17936159,17937798-17937890,17939448-17939489, 17940092-17940202,17940446-17940517,17940596-17940714, 17940981-17941044,17941133-17942782 Length = 1046 Score = 27.9 bits (59), Expect = 6.7 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -1 Query: 579 PCL-KNIMIGICVPSKSXYSIMATMPSQSMDSPV 481 PCL K+ GI P+K ++ TMPS S + + Sbjct: 200 PCLLKDASTGITKPAKEQGKLLVTMPSSSTSTKI 233 >12_02_0844 - 23609783-23609926,23610014-23610331,23610771-23610926, 23611068-23611318,23611384-23611530,23612450-23612501, 23612628-23612763,23613507-23613538 Length = 411 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +2 Query: 347 YLKDYMKKLVXKLEEKAPDQVEVFKTNMNKVMKDILGR 460 YL+D ++ KL EK D E+ + + + M ++LG+ Sbjct: 253 YLEDSKNEVYMKLAEKRVDCQELSEADFEQAMLEVLGK 290 >06_01_1128 + 9300144-9300273,9300340-9300472,9300585-9300656, 9300783-9300926,9301453-9301524,9301584-9301677, 9301782-9301928 Length = 263 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +2 Query: 29 EKPFFRFLLFLIASNPS 79 E PFF FLL L++S+PS Sbjct: 2 EAPFFFFLLLLVSSSPS 18 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,809,979 Number of Sequences: 37544 Number of extensions: 273164 Number of successful extensions: 616 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 603 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 613 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1466594128 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -