BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_B19 (612 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z79754-10|CAB02099.1| 181|Caenorhabditis elegans Hypothetical p... 98 4e-21 AY130758-2|AAN61518.1| 18519|Caenorhabditis elegans 2MDa_2 prote... 29 3.5 AY130758-1|AAN61517.1| 18534|Caenorhabditis elegans 2MDa_1 prote... 29 3.5 Z81072-15|CAB03026.2| 1262|Caenorhabditis elegans Hypothetical p... 28 6.0 Z81048-10|CAB02845.2| 1262|Caenorhabditis elegans Hypothetical p... 28 6.0 Z48544-2|CAA88437.1| 766|Caenorhabditis elegans Hypothetical pr... 28 6.0 U49954-5|AAA93427.2| 445|Caenorhabditis elegans Odorant respons... 27 8.0 U49954-4|AAN84809.1| 473|Caenorhabditis elegans Odorant respons... 27 8.0 U49954-3|AAN84808.1| 475|Caenorhabditis elegans Odorant respons... 27 8.0 AF055911-1|AAC39022.1| 445|Caenorhabditis elegans odorant respo... 27 8.0 >Z79754-10|CAB02099.1| 181|Caenorhabditis elegans Hypothetical protein F25H2.11 protein. Length = 181 Score = 98.3 bits (234), Expect = 4e-21 Identities = 54/140 (38%), Positives = 81/140 (57%), Gaps = 9/140 (6%) Frame = +2 Query: 203 DIQIEGFNPSAEEA--DEGTDSAVESGVDIXLNHRLXETYAFGDKKSYTLYLKDYMKKLV 376 +I + G NPSAEE D+G+D VE G+DI LNH+L E + D + Y+K +MK ++ Sbjct: 41 EIVLAGSNPSAEEGAEDDGSDEHVERGIDIVLNHKLVEMNCYEDASMFKAYIKKFMKNVI 100 Query: 377 XKLEEKAPDQ--VEVFKTNMNKVMKDILG--RFKELQFFTGESM---DCDGMVAMMEYXD 535 +E+ D+ V+ FK + + +L RFK L FF GE +G VA++EY D Sbjct: 101 DHMEKNNRDKADVDAFKKKIQGWVVSLLAKDRFKNLAFFIGERAAEGAENGQVAIIEYRD 160 Query: 536 FDGTQIPIMMFFKHGLQQEK 595 DGT++P +M K + +EK Sbjct: 161 VDGTEVPTLMLVKEAIIEEK 180 Score = 51.6 bits (118), Expect = 4e-07 Identities = 22/40 (55%), Positives = 30/40 (75%) Frame = +1 Query: 82 MKIYKDIITGDEMFSDTYKMKLVDEVIYEVTGRLVTRAQG 201 M IYKDI T DE+ SD++ MKLVD+++YE G+ V R +G Sbjct: 1 MLIYKDIFTDDELSSDSFPMKLVDDLVYEFKGKHVVRKEG 40 >AY130758-2|AAN61518.1| 18519|Caenorhabditis elegans 2MDa_2 protein protein. Length = 18519 Score = 28.7 bits (61), Expect = 3.5 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = +2 Query: 311 TYAFG--DKKSYTLYLKDYMKKLVXKLEEKAPDQVEVFKTNMNKVMKDILGRFKELQ 475 T+ FG D++ Y++ +KD KKL + E+ + TN K + G+ K L+ Sbjct: 11103 TFNFGQKDQEQYSMVMKDVSKKLARQNAEEIQSGKLIPTTNEEKTGLALTGKNKNLK 11159 >AY130758-1|AAN61517.1| 18534|Caenorhabditis elegans 2MDa_1 protein protein. Length = 18534 Score = 28.7 bits (61), Expect = 3.5 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = +2 Query: 311 TYAFG--DKKSYTLYLKDYMKKLVXKLEEKAPDQVEVFKTNMNKVMKDILGRFKELQ 475 T+ FG D++ Y++ +KD KKL + E+ + TN K + G+ K L+ Sbjct: 11103 TFNFGQKDQEQYSMVMKDVSKKLARQNAEEIQSGKLIPTTNEEKTGLALTGKNKNLK 11159 >Z81072-15|CAB03026.2| 1262|Caenorhabditis elegans Hypothetical protein F30A10.10 protein. Length = 1262 Score = 27.9 bits (59), Expect = 6.0 Identities = 15/27 (55%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +2 Query: 221 FNPSAEEADEGTDSAVESG-VDIXLNH 298 F+PSA +ADE D A E G VD L H Sbjct: 1236 FSPSASQADETGDRAPERGFVDTALAH 1262 >Z81048-10|CAB02845.2| 1262|Caenorhabditis elegans Hypothetical protein F30A10.10 protein. Length = 1262 Score = 27.9 bits (59), Expect = 6.0 Identities = 15/27 (55%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +2 Query: 221 FNPSAEEADEGTDSAVESG-VDIXLNH 298 F+PSA +ADE D A E G VD L H Sbjct: 1236 FSPSASQADETGDRAPERGFVDTALAH 1262 >Z48544-2|CAA88437.1| 766|Caenorhabditis elegans Hypothetical protein ZK945.3 protein. Length = 766 Score = 27.9 bits (59), Expect = 6.0 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = +2 Query: 326 DKKSYTLYLKDYMKKLVXKLEEKAPDQVEVFKTNMNKVMKDILGRFKE 469 +KK+ L L +K + K+EEKA K+ ++K +KD L R K+ Sbjct: 22 EKKAKGLKLNKVDRKRIVKIEEKA-----ALKSKVDKAVKDELERLKK 64 >U49954-5|AAA93427.2| 445|Caenorhabditis elegans Odorant response abnormal protein4, isoform a protein. Length = 445 Score = 27.5 bits (58), Expect = 8.0 Identities = 7/35 (20%), Positives = 22/35 (62%) Frame = -1 Query: 132 SVREHLITSDNVLIDLHFDGLEAIKNNKNRKNGFS 28 +++ HL+ + ++LH++ +E ++ ++ K G + Sbjct: 298 AIKHHLVRNLFARVELHYESMEVVEEERSPKTGIT 332 >U49954-4|AAN84809.1| 473|Caenorhabditis elegans Odorant response abnormal protein4, isoform c protein. Length = 473 Score = 27.5 bits (58), Expect = 8.0 Identities = 7/35 (20%), Positives = 22/35 (62%) Frame = -1 Query: 132 SVREHLITSDNVLIDLHFDGLEAIKNNKNRKNGFS 28 +++ HL+ + ++LH++ +E ++ ++ K G + Sbjct: 326 AIKHHLVRNLFARVELHYESMEVVEEERSPKTGIT 360 >U49954-3|AAN84808.1| 475|Caenorhabditis elegans Odorant response abnormal protein4, isoform b protein. Length = 475 Score = 27.5 bits (58), Expect = 8.0 Identities = 7/35 (20%), Positives = 22/35 (62%) Frame = -1 Query: 132 SVREHLITSDNVLIDLHFDGLEAIKNNKNRKNGFS 28 +++ HL+ + ++LH++ +E ++ ++ K G + Sbjct: 328 AIKHHLVRNLFARVELHYESMEVVEEERSPKTGIT 362 >AF055911-1|AAC39022.1| 445|Caenorhabditis elegans odorant response protein ODR-4 protein. Length = 445 Score = 27.5 bits (58), Expect = 8.0 Identities = 7/35 (20%), Positives = 22/35 (62%) Frame = -1 Query: 132 SVREHLITSDNVLIDLHFDGLEAIKNNKNRKNGFS 28 +++ HL+ + ++LH++ +E ++ ++ K G + Sbjct: 298 AIKHHLVRNLFARVELHYESMEVVEEERSPKTGIT 332 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,903,920 Number of Sequences: 27780 Number of extensions: 244300 Number of successful extensions: 760 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 735 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 758 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1321669750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -