BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_B17 (508 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z99281-11|CAB16517.1| 154|Caenorhabditis elegans Hypothetical p... 185 2e-47 U97006-1|AAC47965.1| 2076|Caenorhabditis elegans Hypothetical pr... 27 7.8 >Z99281-11|CAB16517.1| 154|Caenorhabditis elegans Hypothetical protein Y57G11C.16 protein. Length = 154 Score = 185 bits (450), Expect = 2e-47 Identities = 83/131 (63%), Positives = 103/131 (78%) Frame = +3 Query: 57 MSLVIPDKFQHILRIMNTNIDGKRKVMFAMTAIKGVGRRYSNIVLKKADIDLDKRAGECT 236 MSL+IP+KFQHI R+MNTNIDG RKV +A+TAIKGVGRR++ + +KAD+D++KRAGE T Sbjct: 1 MSLIIPEKFQHIHRVMNTNIDGNRKVPYALTAIKGVGRRFAFVCCRKADVDVNKRAGELT 60 Query: 237 EXEVEKIITIMSNPXQYKIPDWFLNRQKDIVDGKYSQLTSSNLDSXXXXXXXXXXXIRAH 416 E + +KI+TIM NP QYKIP+WFLNRQKDI DGK QL S+ +D+ IR H Sbjct: 61 EEDFDKIVTIMQNPSQYKIPNWFLNRQKDIKDGKTGQLLSTAVDNKLREDLERMKKIRLH 120 Query: 417 RGMRHYWGLRV 449 RG+RHYWGLRV Sbjct: 121 RGLRHYWGLRV 131 >U97006-1|AAC47965.1| 2076|Caenorhabditis elegans Hypothetical protein C13F10.4 protein. Length = 2076 Score = 27.1 bits (57), Expect = 7.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 140 CDDGYQRCWPEVLQHCS 190 C + YQ CWP +L CS Sbjct: 1512 CREYYQICWPPILLACS 1528 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,428,864 Number of Sequences: 27780 Number of extensions: 228723 Number of successful extensions: 529 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 524 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 529 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 977860456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -