BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_B17 (508 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g09800.1 68417.m01609 40S ribosomal protein S18 (RPS18C) 184 2e-47 At1g34030.1 68414.m04219 40S ribosomal protein S18 (RPS18B) simi... 184 2e-47 At1g22780.1 68414.m02846 40S ribosomal protein S18 (RPS18A) Matc... 184 2e-47 At3g26618.1 68416.m03325 eukaryotic release factor 1 family prot... 28 4.2 At1g12920.1 68414.m01500 eukaryotic release factor 1 family prot... 28 4.2 At5g47880.1 68418.m05915 eukaryotic peptide chain release factor... 27 5.5 >At4g09800.1 68417.m01609 40S ribosomal protein S18 (RPS18C) Length = 152 Score = 184 bits (449), Expect = 2e-47 Identities = 80/131 (61%), Positives = 105/131 (80%) Frame = +3 Query: 57 MSLVIPDKFQHILRIMNTNIDGKRKVMFAMTAIKGVGRRYSNIVLKKADIDLDKRAGECT 236 MSLV ++FQHILR++NTN+DGK+K+MFA+T+IKG+GRR +NIV KKAD+D++KRAGE + Sbjct: 1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELS 60 Query: 237 EXEVEKIITIMSNPXQYKIPDWFLNRQKDIVDGKYSQLTSSNLDSXXXXXXXXXXXIRAH 416 E++ ++TI++NP Q+KIPDWFLNRQKD DGKYSQ+ S+ LD IR H Sbjct: 61 AAEIDNLMTIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH 120 Query: 417 RGMRHYWGLRV 449 RG+RHYWGLRV Sbjct: 121 RGLRHYWGLRV 131 >At1g34030.1 68414.m04219 40S ribosomal protein S18 (RPS18B) similar to ribosomal protein S18 GI:38422 from [Homo sapiens] Length = 152 Score = 184 bits (449), Expect = 2e-47 Identities = 80/131 (61%), Positives = 105/131 (80%) Frame = +3 Query: 57 MSLVIPDKFQHILRIMNTNIDGKRKVMFAMTAIKGVGRRYSNIVLKKADIDLDKRAGECT 236 MSLV ++FQHILR++NTN+DGK+K+MFA+T+IKG+GRR +NIV KKAD+D++KRAGE + Sbjct: 1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELS 60 Query: 237 EXEVEKIITIMSNPXQYKIPDWFLNRQKDIVDGKYSQLTSSNLDSXXXXXXXXXXXIRAH 416 E++ ++TI++NP Q+KIPDWFLNRQKD DGKYSQ+ S+ LD IR H Sbjct: 61 AAEIDNLMTIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH 120 Query: 417 RGMRHYWGLRV 449 RG+RHYWGLRV Sbjct: 121 RGLRHYWGLRV 131 >At1g22780.1 68414.m02846 40S ribosomal protein S18 (RPS18A) Match to ribosomal S18 gene mRNA gb|Z28701, DNA gb|Z23165 from A. thaliana. ESTs gb|T21121, gb|Z17755, gb|R64776 and gb|R30430 come from this gene Length = 152 Score = 184 bits (449), Expect = 2e-47 Identities = 80/131 (61%), Positives = 105/131 (80%) Frame = +3 Query: 57 MSLVIPDKFQHILRIMNTNIDGKRKVMFAMTAIKGVGRRYSNIVLKKADIDLDKRAGECT 236 MSLV ++FQHILR++NTN+DGK+K+MFA+T+IKG+GRR +NIV KKAD+D++KRAGE + Sbjct: 1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELS 60 Query: 237 EXEVEKIITIMSNPXQYKIPDWFLNRQKDIVDGKYSQLTSSNLDSXXXXXXXXXXXIRAH 416 E++ ++TI++NP Q+KIPDWFLNRQKD DGKYSQ+ S+ LD IR H Sbjct: 61 AAEIDNLMTIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNH 120 Query: 417 RGMRHYWGLRV 449 RG+RHYWGLRV Sbjct: 121 RGLRHYWGLRV 131 >At3g26618.1 68416.m03325 eukaryotic release factor 1 family protein / eRF1 family protein contains Pfam profiles: PF03463 eRF1 domain 1, PF03464 eRF1 domain 2, PF03465 eRF1 domain 3 Length = 435 Score = 27.9 bits (59), Expect = 4.2 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -1 Query: 79 LSGMTSDILVKFLTNVPKHNSRGNE 5 LSG T ++L KF ++PK + RG + Sbjct: 159 LSGNTREVLHKFTVDLPKKHGRGGQ 183 >At1g12920.1 68414.m01500 eukaryotic release factor 1 family protein / eRF1 family protein contains Pfam profiles: PF03463 eRF1 domain 1, PF03464 eRF1 domain 2, PF03465 eRF1 domain 3 Length = 434 Score = 27.9 bits (59), Expect = 4.2 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -1 Query: 79 LSGMTSDILVKFLTNVPKHNSRGNE 5 LSG T ++L KF ++PK + RG + Sbjct: 158 LSGNTREVLHKFTVDLPKKHGRGGQ 182 >At5g47880.1 68418.m05915 eukaryotic peptide chain release factor subunit 1-1 (ERF1-1) identical to SP|Q39097 Eukaryotic peptide chain release factor subunit 1-1 (eRF1-1) (Eukaryotic release factor 1-1) (Omnipotent suppressor protein 1 homolog 1) (SUP1 homolog 1) {Arabidopsis thaliana}, eukaryotic release factor 1 homolog GI:1155261 from [Arabidopsis thaliana]; contains Pfam profiles: PF03463 eRF1 domain 1, PF03464 eRF1 domain 2, PF03465 eRF1 domain 3 Length = 436 Score = 27.5 bits (58), Expect = 5.5 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -1 Query: 79 LSGMTSDILVKFLTNVPKHNSRGNE 5 LSG T ++L KF ++PK + RG + Sbjct: 160 LSGNTREVLHKFSVDLPKKHGRGGQ 184 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,705,037 Number of Sequences: 28952 Number of extensions: 207101 Number of successful extensions: 470 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 461 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 470 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 908059136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -