BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_B15 (509 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55959| Best HMM Match : No HMM Matches (HMM E-Value=.) 165 1e-41 SB_35369| Best HMM Match : Helicase_C (HMM E-Value=6.1e-05) 30 0.96 SB_50663| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_11738| Best HMM Match : SH3_2 (HMM E-Value=3.7e-32) 30 1.3 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 30 1.3 SB_9375| Best HMM Match : Sec6 (HMM E-Value=0.35) 29 2.2 SB_27024| Best HMM Match : Pkinase (HMM E-Value=4.7e-25) 28 3.9 SB_41095| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_40712| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_39346| Best HMM Match : Drf_FH1 (HMM E-Value=0.027) 27 9.0 SB_25171| Best HMM Match : Drf_FH1 (HMM E-Value=0.032) 27 9.0 SB_38790| Best HMM Match : E-MAP-115 (HMM E-Value=1.9) 27 9.0 SB_37931| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_20049| Best HMM Match : 7tm_1 (HMM E-Value=6.2e-05) 27 9.0 SB_17138| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_4274| Best HMM Match : LRV (HMM E-Value=5.7) 27 9.0 >SB_55959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 165 bits (402), Expect = 1e-41 Identities = 78/95 (82%), Positives = 88/95 (92%), Gaps = 2/95 (2%) Frame = +2 Query: 200 RNVRSLEKV--CADLINGAKKQKLRVKGPVRMPTKILRITTRKTPCGEGSKTWDRFQMRI 373 + VR+ KV CADLI GAK++KL+VKGPVRMPTK LRITTRKTPCGEGSKTWDR++MRI Sbjct: 6 KKVRTTRKVTVCADLIRGAKEKKLKVKGPVRMPTKFLRITTRKTPCGEGSKTWDRYEMRI 65 Query: 374 HKRVIDLHSPSEIVKQITSINIEPGVQVEVTIADA 478 HKR+IDLHSPSEIVKQITSI+IEPGV+VEVTIADA Sbjct: 66 HKRLIDLHSPSEIVKQITSISIEPGVEVEVTIADA 100 >SB_35369| Best HMM Match : Helicase_C (HMM E-Value=6.1e-05) Length = 584 Score = 30.3 bits (65), Expect = 0.96 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +1 Query: 199 SQCALTREGLC*PHQWSQETEAACKGPSPHANQDPAYHHP 318 S C GLC P + ++ + GPSP + DP+ P Sbjct: 412 SICLCAPSGLCVPIHFLPNSDPSLAGPSPSSKLDPSIRDP 451 >SB_50663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 437 Score = 29.9 bits (64), Expect = 1.3 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = +1 Query: 169 YPPHQDHSYFSQCALTR---EGLC*PHQWSQETEAACKGPSPHANQDPAYHHP 318 Y P +SY + CA T+ +G + A+ + PH N DPA+ P Sbjct: 267 YDPQNPYSYGAYCAYTQAQPQGFNAQAYPYENNSASARPAMPHYNSDPAHTEP 319 >SB_11738| Best HMM Match : SH3_2 (HMM E-Value=3.7e-32) Length = 2436 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +2 Query: 134 KDIEKPQAEVSPIHRIRITLTSRNVRSLEKVCAD 235 + + K Q E + IH + +T ++VRSLE+ C + Sbjct: 663 RQLHKIQEESTRIHHLAVTALEKDVRSLEQRCLE 696 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 29.9 bits (64), Expect = 1.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 238 HQWSQETEAACKGPSPHANQDPAYHHPEN 324 H + + GP PH+ Q P HHP++ Sbjct: 1177 HHPHEPHQVQAMGPPPHSMQQPLLHHPQD 1205 >SB_9375| Best HMM Match : Sec6 (HMM E-Value=0.35) Length = 1049 Score = 29.1 bits (62), Expect = 2.2 Identities = 19/47 (40%), Positives = 23/47 (48%) Frame = -2 Query: 499 FYWRLCLRVGDGHLNLYTGLDVN*GDLFHDFRGRV*VDHSLVDSHLK 359 FY L L V D L G+D DLF + R VD+SLV +K Sbjct: 405 FYSNLVLEVSDNETELVNGIDQLWDDLFVESRR---VDYSLVSVKMK 448 >SB_27024| Best HMM Match : Pkinase (HMM E-Value=4.7e-25) Length = 1595 Score = 28.3 bits (60), Expect = 3.9 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +1 Query: 34 EVSPASALNNF*LKSCLSRPEFNKQHGSRCSVRQRHRETP-GRGLPY 171 E++P +L + L R E K+H S++ ++TP GRGL Y Sbjct: 454 ELAPHGSLASVMEDITLGRRETEKEHVGAKSIKYETKQTPLGRGLTY 500 >SB_41095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 561 Score = 27.1 bits (57), Expect = 9.0 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 506 KNILLAALPTRRRWSPQP 453 +N+++ LPT +RW P P Sbjct: 180 RNVVIQRLPTSQRWQPYP 197 >SB_40712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 27.1 bits (57), Expect = 9.0 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +2 Query: 284 RMPTKILRITT-RKTPCGEGSKTWDRFQMRIHKRVIDLHSPSEI 412 R+PT + T +K PC TW R + KR + +H P+ + Sbjct: 22 RVPTAFPSVATGKKYPCQRKKVTWSR-KKNPFKRRVPVHVPTSL 64 >SB_39346| Best HMM Match : Drf_FH1 (HMM E-Value=0.027) Length = 345 Score = 27.1 bits (57), Expect = 9.0 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -3 Query: 495 IGGSAYASAMVTSTCTPGSMLIEVIC--FTISEGECRSITLL 376 +GGS Y ++ + CTP + L+E C + E C TLL Sbjct: 292 LGGSLYPYPLLEAPCTP-TPLLEATCTPTPLLEATCTPTTLL 332 >SB_25171| Best HMM Match : Drf_FH1 (HMM E-Value=0.032) Length = 244 Score = 27.1 bits (57), Expect = 9.0 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -3 Query: 495 IGGSAYASAMVTSTCTPGSMLIEVIC--FTISEGECRSITLL 376 +GGS Y ++ + CTP + L+E C + E C TLL Sbjct: 191 LGGSLYPYPLLEAPCTP-TPLLEATCTPTPLLEATCTPTTLL 231 >SB_38790| Best HMM Match : E-MAP-115 (HMM E-Value=1.9) Length = 198 Score = 27.1 bits (57), Expect = 9.0 Identities = 17/39 (43%), Positives = 20/39 (51%) Frame = +1 Query: 112 GSRCSVRQRHRETPGRGLPYPPHQDHSYFSQCALTREGL 228 GSR R RHR PGR P P S+ ++ A R GL Sbjct: 2 GSRSHRRARHRGGPGRRRPLKP----SFTTEGAAARLGL 36 >SB_37931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 361 Score = 27.1 bits (57), Expect = 9.0 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +2 Query: 101 TSNMAAAVVSGKDIEKPQAEVSPIHRIRITLTSRNVRSLEK 223 T N A+ ++S + +PQA + P+H I + SRN ++ K Sbjct: 306 TLNSASVILS---LAEPQAGILPVHPHSIEIASRNRDAIAK 343 >SB_20049| Best HMM Match : 7tm_1 (HMM E-Value=6.2e-05) Length = 1023 Score = 27.1 bits (57), Expect = 9.0 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +1 Query: 73 KSCLSRPEFNKQHGSRCS-VRQRHRETPGRGLPYPPHQ 183 +S ++ + +H S S V+ R+R G+G+ Y PHQ Sbjct: 744 RSQINVTRYRPRHPSSTSTVKYRYRLWTGKGVDYQPHQ 781 >SB_17138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 490 Score = 27.1 bits (57), Expect = 9.0 Identities = 28/104 (26%), Positives = 45/104 (43%), Gaps = 1/104 (0%) Frame = +2 Query: 128 SGKDIEKPQAEVSPIHRIRITLTSR-NVRSLEKVCADLINGAKKQKLRVKGPVRMPTKIL 304 S + +K +VSP+ RI+ TSR ++ S DL + K K K P+ P Sbjct: 124 STRSSKKDPDKVSPLSRIKSPATSRVSLDSDSDDGNDLPSVFTKTKPVWKPPITTPQVNS 183 Query: 305 RITTRKTPCGEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSIN 436 P + + D ++R HKR+ D +S ++ S N Sbjct: 184 DSEEEDLPSYLSTNSQDT-KIRTHKRIADNNSKISCRSKVDSQN 226 >SB_4274| Best HMM Match : LRV (HMM E-Value=5.7) Length = 327 Score = 27.1 bits (57), Expect = 9.0 Identities = 17/66 (25%), Positives = 31/66 (46%) Frame = -2 Query: 331 ARSFPGGDTQDLGWHADWALYTQLLFLGSIDEVSTDLLE*AHIARSKSDPDAVDRGDLCL 152 A+ P G D + + W YTQL F S+ + + D ++ S + +R D+ + Sbjct: 127 AQHKPSGWGTDEVYQSSWEFYTQLQFANSVCDDTDDTID-TITGPSTAKKRKKERDDIEV 185 Query: 151 GFLDVF 134 L++F Sbjct: 186 NKLELF 191 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,137,698 Number of Sequences: 59808 Number of extensions: 390897 Number of successful extensions: 890 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 853 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 890 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1123894172 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -