BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_B15 (509 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY645022-1|AAT92558.1| 165|Anopheles gambiae hairy protein. 23 4.5 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 23 4.5 >AY645022-1|AAT92558.1| 165|Anopheles gambiae hairy protein. Length = 165 Score = 23.4 bits (48), Expect = 4.5 Identities = 11/54 (20%), Positives = 24/54 (44%) Frame = +1 Query: 169 YPPHQDHSYFSQCALTREGLC*PHQWSQETEAACKGPSPHANQDPAYHHPENSL 330 Y P + HS + + + G HQ S + ++ S ++ ++ P++ L Sbjct: 83 YEPMECHSAVNSSSNSSTGYLHQHQQSSSSSSSSSSSSMSSSSSSSFSSPDSPL 136 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 23.4 bits (48), Expect = 4.5 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -1 Query: 350 RSLNLHRKEFSGW*YAGSWLACGLGPL 270 RSLN+ R F G ++ W + PL Sbjct: 659 RSLNIRRGIFQGDTFSTLWFCLAMNPL 685 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 566,724 Number of Sequences: 2352 Number of extensions: 12777 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46091631 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -