BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_B11 (461 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0970 + 21338072-21338074,21338192-21338240,21338688-213389... 133 6e-32 02_04_0177 + 20669053-20669055,20669150-20669198,20669680-206699... 133 6e-32 01_07_0270 - 42417782-42417850,42418207-42418342,42418826-424191... 126 9e-30 01_07_0054 - 40779336-40779599,40779734-40779848,40779998-407801... 31 0.60 05_04_0080 - 17742425-17742578,17742855-17743038,17743202-177432... 27 7.3 12_01_0858 + 8072608-8072931,8072990-8073028 27 9.7 06_01_0238 + 1815258-1815581,1816286-1816530,1816612-1816765,181... 27 9.7 01_01_0972 + 7672048-7672390,7672546-7672709,7672864-7672961,767... 27 9.7 01_01_0743 - 5763654-5766902 27 9.7 >04_03_0970 + 21338072-21338074,21338192-21338240,21338688-21338970, 21339570-21339705,21339761-21339769 Length = 159 Score = 133 bits (322), Expect = 6e-32 Identities = 59/97 (60%), Positives = 80/97 (82%) Frame = +1 Query: 31 MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 210 M++PK+NR I +YLF+EGV+ AKKDY+ KH +++ +PNLQVIK MQS KS+ YV+E F Sbjct: 1 MIIPKKNRNEICKYLFQEGVLYAKKDYNLAKHPQID-VPNLQVIKLMQSFKSKEYVRETF 59 Query: 211 AWRHFYWYLTNXGIEYLXIFLHLPPEIVPATLKRSVR 321 +W+++YWYLTN GIE+L +L+LP EIVPATLK+S R Sbjct: 60 SWQYYYWYLTNDGIEHLRNYLNLPSEIVPATLKKSAR 96 >02_04_0177 + 20669053-20669055,20669150-20669198,20669680-20669962, 20670526-20670661,20671014-20671094 Length = 183 Score = 133 bits (322), Expect = 6e-32 Identities = 59/97 (60%), Positives = 80/97 (82%) Frame = +1 Query: 31 MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 210 M++PK+NR I +YLF+EGV+ AKKDY+ KH +++ +PNLQVIK MQS KS+ YV+E F Sbjct: 1 MIIPKKNRNEICKYLFQEGVLYAKKDYNLAKHPQID-VPNLQVIKLMQSFKSKEYVRETF 59 Query: 211 AWRHFYWYLTNXGIEYLXIFLHLPPEIVPATLKRSVR 321 +W+++YWYLTN GIE+L +L+LP EIVPATLK+S R Sbjct: 60 SWQYYYWYLTNDGIEHLRNYLNLPSEIVPATLKKSAR 96 >01_07_0270 - 42417782-42417850,42418207-42418342,42418826-42419108, 42419459-42419507,42419614-42419616 Length = 179 Score = 126 bits (304), Expect = 9e-30 Identities = 55/97 (56%), Positives = 77/97 (79%) Frame = +1 Query: 31 MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 210 M++ K+NR I +YLF EGV+ AKKDY+ KH +++ +PNL+VIK MQS KS+ YV+E F Sbjct: 1 MIISKKNRREICKYLFHEGVLYAKKDYNLAKHPKVD-VPNLEVIKLMQSFKSKEYVRETF 59 Query: 211 AWRHFYWYLTNXGIEYLXIFLHLPPEIVPATLKRSVR 321 +W+H+YWYLTN GIE+L +L+LP E+VP TLK+S + Sbjct: 60 SWQHYYWYLTNDGIEHLRSYLNLPSEVVPNTLKKSAK 96 >01_07_0054 - 40779336-40779599,40779734-40779848,40779998-40780181, 40780322-40780393,40780485-40780611,40780830-40781011, 40781099-40781249 Length = 364 Score = 30.7 bits (66), Expect = 0.60 Identities = 17/65 (26%), Positives = 31/65 (47%), Gaps = 1/65 (1%) Frame = +1 Query: 61 IYEYLFKEGVMVA-KKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQFAWRHFYWYL 237 +Y+ L ++G +VA KK + P H + ++ L I+ + GY +E Y Y+ Sbjct: 84 VYKGLLQDGTIVAIKKRHSPPSHEFIHEVNYLSSIRHRNLVNLLGYCQENGMQMLVYEYV 143 Query: 238 TNXGI 252 N + Sbjct: 144 PNGSV 148 >05_04_0080 - 17742425-17742578,17742855-17743038,17743202-17743273, 17743343-17743469,17743915-17744135,17744234-17744387 Length = 303 Score = 27.1 bits (57), Expect = 7.3 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 1/65 (1%) Frame = +1 Query: 61 IYEYLFKEGVMVA-KKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQFAWRHFYWYL 237 +Y+ L +G +VA KK AP+ E++ L I + GY +E Y YL Sbjct: 98 VYKGLLLDGSVVAIKKRIGAPRQEFAEEVRKLSEINHRNIVTLIGYCQEGGLQMLVYEYL 157 Query: 238 TNXGI 252 N + Sbjct: 158 PNGSV 162 >12_01_0858 + 8072608-8072931,8072990-8073028 Length = 120 Score = 26.6 bits (56), Expect = 9.7 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -1 Query: 455 GPTSAFLS*GATPGAAGVRLYADLSSAERAGA 360 GP+SA +S G AG + AD + RAGA Sbjct: 49 GPSSARISVDPAAGTAGAAVAADGQARARAGA 80 >06_01_0238 + 1815258-1815581,1816286-1816530,1816612-1816765, 1817043-1817257,1817351-1817468,1817685-1817895, 1818133-1818194,1818306-1818524 Length = 515 Score = 26.6 bits (56), Expect = 9.7 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = -1 Query: 410 AGVRLYADLSSAERAGASGRPTGPRRTVSVRTERLSVAGTISGG 279 A V L+AD +A R AS R R V++RTE + ++ G Sbjct: 408 AVVALFADGPTAIRDVASWRVKETERMVAIRTELTKLGASVEEG 451 >01_01_0972 + 7672048-7672390,7672546-7672709,7672864-7672961, 7673040-7673361,7674021-7675220 Length = 708 Score = 26.6 bits (56), Expect = 9.7 Identities = 22/80 (27%), Positives = 33/80 (41%), Gaps = 2/80 (2%) Frame = +1 Query: 7 VSLQAAFKMLMPKQNRVAIYEYLFKEGVMVAK--KDYHAPKHTELEKIPNLQVIKAMQSL 180 V+ + F L + + Y+ ++ G VA +H PK K+ + AM Sbjct: 156 VTFSSLFCTLPLRNTMIVDYKLIYPSGSAVAGIVNSFHTPKGATKAKLQ----VNAM--F 209 Query: 181 KSRGYVKEQFAWRHFYWYLT 240 KS V FAW F W+ T Sbjct: 210 KS---VAGSFAWAFFQWFYT 226 >01_01_0743 - 5763654-5766902 Length = 1082 Score = 26.6 bits (56), Expect = 9.7 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -1 Query: 389 DLSSAERAGASGRPTGPRRTVSVRTERLSVAGTI 288 + +SA R + R PR V V+ ERL AG + Sbjct: 44 EAASAPRGAKNSRSRAPRTDVDVQIERLCRAGEL 77 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,581,366 Number of Sequences: 37544 Number of extensions: 178871 Number of successful extensions: 478 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 472 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 475 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 919380308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -