BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_B11 (461 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69981-1|CAA93821.1| 327|Anopheles gambiae maltase precursor pr... 23 5.2 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 5.2 >Z69981-1|CAA93821.1| 327|Anopheles gambiae maltase precursor protein. Length = 327 Score = 23.0 bits (47), Expect = 5.2 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 81 RGSHGGQKRLSCTEAY*T 134 + HGG+ R+ TEAY T Sbjct: 9 QAEHGGETRVIMTEAYST 26 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.0 bits (47), Expect = 5.2 Identities = 11/51 (21%), Positives = 25/51 (49%) Frame = +1 Query: 121 KHTELEKIPNLQVIKAMQSLKSRGYVKEQFAWRHFYWYLTNXGIEYLXIFL 273 K+ +L+K + A+++ R Y+ + +W++T+ EY+ L Sbjct: 1134 KNCDLDKNQRNCIEFALKAKPIRRYIPKHRIQYKVWWFVTSQPFEYMIFVL 1184 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 404,116 Number of Sequences: 2352 Number of extensions: 6732 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 39969834 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -