BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_B10 (654 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53271| Best HMM Match : No HMM Matches (HMM E-Value=.) 333 8e-92 SB_6632| Best HMM Match : FAD_binding_4 (HMM E-Value=1.70006e-41) 30 1.4 SB_49186| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_11242| Best HMM Match : MAM (HMM E-Value=0) 29 4.4 SB_46368| Best HMM Match : DUF156 (HMM E-Value=6.5) 28 5.8 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_20359| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 >SB_53271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 687 Score = 333 bits (818), Expect = 8e-92 Identities = 149/195 (76%), Positives = 172/195 (88%) Frame = +1 Query: 70 MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 249 MARGPKKH+KRLNAPK WMLDKL GV+APRPSTGPHKLRECLPL+IFLRNRLKYAL G E Sbjct: 425 MARGPKKHMKRLNAPKHWMLDKLSGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALNGEE 484 Query: 250 VLKIVKQRLIKVDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAK 429 V KIVKQRLIK+DGKVRTD TYPAGFMDVV+I+KT E FRL+YDVKGRF +HRIT EEAK Sbjct: 485 VKKIVKQRLIKIDGKVRTDTTYPAGFMDVVTIDKTGENFRLLYDVKGRFAVHRITAEEAK 544 Query: 430 YKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIATTKIMDFIKFESGNL 609 YKL +V+RV G K VPY+VTHD RTIRYPDP IKVND++ +DI T K++D+IKF++GN+ Sbjct: 545 YKLGRVRRVDVGAKGVPYIVTHDARTIRYPDPNIKVNDTVVIDIKTGKVIDYIKFDTGNM 604 Query: 610 CMITGGRNLGRVGTI 654 M+ GGRN+GRVG + Sbjct: 605 AMVVGGRNMGRVGMV 619 >SB_6632| Best HMM Match : FAD_binding_4 (HMM E-Value=1.70006e-41) Length = 482 Score = 30.3 bits (65), Expect = 1.4 Identities = 17/72 (23%), Positives = 35/72 (48%) Frame = +1 Query: 400 IHRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIATTKIM 579 I +TP+ K C+V R++TGP +++ +G + +++ ++ + + + Sbjct: 287 IRMVTPQGTVEKSCQVPRMSTGPDLHHFIMGSEGTLGVITEVTLRIRPVPEIRVYGSVV- 345 Query: 580 DFIKFESGNLCM 615 F FE G CM Sbjct: 346 -FPDFEKGVACM 356 >SB_49186| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1776 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/56 (19%), Positives = 28/56 (50%) Frame = +1 Query: 226 KYALTGNEVLKIVKQRLIKVDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGR 393 +Y L ++ + + L++ G + P+YP+ ++ ++ +N+LF + R Sbjct: 596 EYWLMASQGQHVSESTLVRGRGDILISPSYPSALLETTTLITSNQLFNTFIESSTR 651 >SB_11242| Best HMM Match : MAM (HMM E-Value=0) Length = 348 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/20 (60%), Positives = 16/20 (80%), Gaps = 2/20 (10%) Frame = +3 Query: 213 EES--SEVCFDRKRSPENCE 266 EES +E+C DRKR P++CE Sbjct: 76 EESRYNELCHDRKRGPDDCE 95 >SB_46368| Best HMM Match : DUF156 (HMM E-Value=6.5) Length = 203 Score = 28.3 bits (60), Expect = 5.8 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = -2 Query: 212 RKITRGKHSRNLWGPVDGLGAYTPPSLSNIHALGAF-KRFKCFLGPRAMLDK 60 RK +R N++G ++GLG+ PP + I F K K F PR K Sbjct: 60 RKRSRSLPRTNVFGTLNGLGSPPPPRDNRIDEYAEFTKSQKSFTFPRRSKQK 111 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 6/45 (13%) Frame = -2 Query: 290 PSTFMRRCFTIFRTSFPVKAYFRRFLRK------ITRGKHSRNLW 174 PS++ F +FRT FP + RF R+ IT ++LW Sbjct: 84 PSSYNGHQFLVFRTDFPFSKHKNRFKRRTKYLYVITTSTKHQHLW 128 >SB_20359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4700 Score = 27.9 bits (59), Expect = 7.6 Identities = 18/79 (22%), Positives = 35/79 (44%), Gaps = 3/79 (3%) Frame = +1 Query: 418 EEAKYKLCKVKRVATGPKNVPYLVTHDG---RTIRYPDPLIKVNDSIQLDIATTKIMDFI 588 E+A +C++ R+ P+ LV G +++ I + Q+ + + + Sbjct: 2971 EDAMQHVCRINRILESPRGNALLVGVGGSGKQSLARLAAFISALEVFQITLRKGYGIPDM 3030 Query: 589 KFESGNLCMITGGRNLGRV 645 K + NLC G +N+G V Sbjct: 3031 KLDLANLCTKAGLKNIGTV 3049 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,938,144 Number of Sequences: 59808 Number of extensions: 477229 Number of successful extensions: 1160 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1081 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1159 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -