BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_B07 (654 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 23 2.6 S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor prot... 23 3.4 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 23.0 bits (47), Expect = 2.6 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = -2 Query: 227 CLCHFCGSRRFCCF 186 C C C S+ CCF Sbjct: 435 CECKTCNSKTKCCF 448 >S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor protein. Length = 169 Score = 22.6 bits (46), Expect = 3.4 Identities = 11/50 (22%), Positives = 20/50 (40%) Frame = +1 Query: 250 APRLLLAAWTVYSPVSKMIQTNMTNRFCICSADTTCAITEDDTEVHAYIH 399 +P +L++ + + +M F CS+ T A T Y+H Sbjct: 91 SPTILISYIYILMAILRMSADGGCRNFSTCSSHPTAAFISYGTLFFIYVH 140 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,009 Number of Sequences: 438 Number of extensions: 2590 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -