BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_B07 (654 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g41220.1 68415.m05090 glutamate synthase, chloroplast (GLU2) ... 34 0.095 At5g04140.2 68418.m00402 glutamate synthase (GLU1) / ferredoxin-... 32 0.29 At5g04140.1 68418.m00401 glutamate synthase (GLU1) / ferredoxin-... 32 0.29 At1g56520.1 68414.m06499 disease resistance protein (TIR-NBS-LRR... 29 2.7 At1g66810.1 68414.m07594 zinc finger (CCCH-type) family protein ... 28 4.7 At3g52130.1 68416.m05722 protease inhibitor/seed storage/lipid t... 27 8.2 >At2g41220.1 68415.m05090 glutamate synthase, chloroplast (GLU2) / ferredoxin-dependent glutamate synthase (Fd-GOGAT 2) identical to SP|Q9T0P4 Ferredoxin-dependent glutamate synthase 2, chloroplast precursor (EC 1.4.7.1) (Fd-GOGAT 2) {Arabidopsis thaliana} Length = 1629 Score = 33.9 bits (74), Expect = 0.095 Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = -1 Query: 456 AISCQHTKLLRVGINASASVNVRVHFCIVFGNSACGVG*ANAESVC-HVSLYHLRNWRIN 280 A+ H L++ G+ SAS+ C + AC +G A ++C H++L R WR++ Sbjct: 733 AVGAVHQHLIQNGLRMSASIIADTAQCFSTHHFACLIG-YGASAICPHLALETCRQWRLS 791 Query: 279 S 277 + Sbjct: 792 N 792 >At5g04140.2 68418.m00402 glutamate synthase (GLU1) / ferredoxin-dependent glutamate synthase (Fd-GOGAT 1) identical to ferredoxin-dependent glutamate synthase precursor [Arabidopsis thaliana] GI:3869251 Length = 1648 Score = 32.3 bits (70), Expect = 0.29 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = -1 Query: 456 AISCQHTKLLRVGINASASVNVRVHFCIVFGNSACGVG*ANAESVC-HVSLYHLRNWRIN 280 A+ H L++ G+ SAS+ C + AC VG A +VC +++L R WR++ Sbjct: 757 AVGAVHQHLIQNGLRMSASIVADTAQCFSTHHFACLVG-YGASAVCPYLALETCRQWRLS 815 Query: 279 S 277 + Sbjct: 816 N 816 >At5g04140.1 68418.m00401 glutamate synthase (GLU1) / ferredoxin-dependent glutamate synthase (Fd-GOGAT 1) identical to ferredoxin-dependent glutamate synthase precursor [Arabidopsis thaliana] GI:3869251 Length = 1622 Score = 32.3 bits (70), Expect = 0.29 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = -1 Query: 456 AISCQHTKLLRVGINASASVNVRVHFCIVFGNSACGVG*ANAESVC-HVSLYHLRNWRIN 280 A+ H L++ G+ SAS+ C + AC VG A +VC +++L R WR++ Sbjct: 731 AVGAVHQHLIQNGLRMSASIVADTAQCFSTHHFACLVG-YGASAVCPYLALETCRQWRLS 789 Query: 279 S 277 + Sbjct: 790 N 790 >At1g56520.1 68414.m06499 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 897 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 228 SGNKPIICAPTTPCRLDCLFA 290 SG K ++ P PC L+CLFA Sbjct: 792 SGCKRLVSLPELPCSLECLFA 812 >At1g66810.1 68414.m07594 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 310 Score = 28.3 bits (60), Expect = 4.7 Identities = 17/58 (29%), Positives = 25/58 (43%) Frame = -2 Query: 311 VCIILETGE*TVQAARSSRGANYGLISRCLCHFCGSRRFCCFGSLCRRLSGICYLEPV 138 VC++ GE + A G++ LC+ CC+G C+ GI L PV Sbjct: 211 VCVVQTKGE---REALELEVYRQGMMKTELCNKWQETGACCYGDNCQFAHGIDELRPV 265 >At3g52130.1 68416.m05722 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to cysteine-rich 5B protein - Lycopersicon esculentum, PIR2:S39552 [GI:415833]; contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 125 Score = 27.5 bits (58), Expect = 8.2 Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = +2 Query: 341 QPTPHALLPKT-IQKCTRTFTDALA-LIPTRSS 433 QP P +LP+ + C+RTF AL LIP R++ Sbjct: 33 QPPPPPMLPEEEVGGCSRTFFSALVQLIPCRAA 65 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,098,333 Number of Sequences: 28952 Number of extensions: 192589 Number of successful extensions: 415 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 410 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 415 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -