BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_B05 (636 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC18.01c |adg3|SPCC74.07c|beta-glucosidase Adg3 |Schizosacchar... 31 0.11 SPAC22A12.01c |pso2|snm1, SPAC56F8.17c, snm1|DNA 5' exonuclease ... 25 6.9 >SPCC18.01c |adg3|SPCC74.07c|beta-glucosidase Adg3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 1131 Score = 31.5 bits (68), Expect = 0.11 Identities = 22/82 (26%), Positives = 39/82 (47%), Gaps = 2/82 (2%) Frame = +2 Query: 221 NVTKYNSTLXETSLXRINLFKEALSSAXNGRVLYILHEELSQLPTLSQDLNSVNRHFM-- 394 N+T +STL + ++ ++S+ + L + S TLS+ ++S+N + + Sbjct: 920 NITVTSSTLKPSLTSSVSTASSYIASSASSNTLSTEPKTFSSSSTLSESISSINTNSLTV 979 Query: 395 KMISFLYVXTIEALIDSVSTLP 460 K S L T L S ST+P Sbjct: 980 KPESSLSSSTTSGLTSSSSTIP 1001 >SPAC22A12.01c |pso2|snm1, SPAC56F8.17c, snm1|DNA 5' exonuclease |Schizosaccharomyces pombe|chr 1|||Manual Length = 560 Score = 25.4 bits (53), Expect = 6.9 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = +2 Query: 446 VSTLPDWQNVPSTIILXDLSKFFSRNXXQTLWGLLLC 556 V P WQ+ IL L +N T+ LLLC Sbjct: 73 VGESPQWQSFGDANILEPLKNELVKNEESTMSELLLC 109 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,308,081 Number of Sequences: 5004 Number of extensions: 41099 Number of successful extensions: 84 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 83 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 84 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 283719918 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -