BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_B05 (636 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1091 + 23899825-23900649,23900750-23900998,23901104-239011... 27 9.4 01_05_0582 - 23411593-23411626,23413276-23413361,23413713-234137... 27 9.4 >07_03_1091 + 23899825-23900649,23900750-23900998,23901104-23901195, 23901413-23902193 Length = 648 Score = 27.5 bits (58), Expect = 9.4 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +3 Query: 483 QLFXMT*ASSSVETXXKHYGDYCSVMDSVRXCSVSLGKPCNYLLL 617 Q+ +T A S H+G Y + DS R C VSL + L+L Sbjct: 60 QVTNITPALSGANPFSGHHGFYLRLSDSARSCYVSLHADHDDLIL 104 >01_05_0582 - 23411593-23411626,23413276-23413361,23413713-23413737, 23413765-23413823,23414301-23414333 Length = 78 Score = 27.5 bits (58), Expect = 9.4 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +2 Query: 326 LHEELSQLPTLSQDLNSVNRHFMKMISFLYVXTIEALIDSVSTLPDWQNV 475 ++ ++ L LS+ RH+ ISFLY+ I+ + V +QN+ Sbjct: 3 INVDIKYLQNLSEQAALSLRHYKVPISFLYIQLIQVQSNFVHFFKSFQNM 52 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,777,332 Number of Sequences: 37544 Number of extensions: 197979 Number of successful extensions: 306 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 302 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 306 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1561213104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -