BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_B02 (508 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3960| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 5e-23 SB_41974| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_46463| Best HMM Match : Pox_A32 (HMM E-Value=0.04) 38 0.005 SB_58963| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.019 SB_47817| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_40686| Best HMM Match : rve (HMM E-Value=0.00016) 36 0.025 SB_59010| Best HMM Match : rve (HMM E-Value=0.0052) 35 0.034 SB_41374| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.077 SB_34881| Best HMM Match : DUF1118 (HMM E-Value=2.8) 34 0.077 SB_10027| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.31) 33 0.10 SB_2035| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.10 SB_35738| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_18915| Best HMM Match : Pox_A32 (HMM E-Value=0.052) 33 0.14 SB_13424| Best HMM Match : Pox_A32 (HMM E-Value=0.073) 33 0.18 SB_12028| Best HMM Match : DAG1 (HMM E-Value=0.22) 33 0.18 SB_10503| Best HMM Match : Ribosomal_60s (HMM E-Value=0.46) 32 0.24 SB_10435| Best HMM Match : PRAI (HMM E-Value=1.7) 32 0.24 SB_49595| Best HMM Match : POPLD (HMM E-Value=1.1) 32 0.24 SB_45055| Best HMM Match : Ribosomal_60s (HMM E-Value=0.46) 32 0.24 SB_42720| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.24 SB_13336| Best HMM Match : Pox_A32 (HMM E-Value=0.049) 32 0.24 SB_44641| Best HMM Match : rve (HMM E-Value=1.9e-19) 32 0.31 SB_56647| Best HMM Match : rve (HMM E-Value=1.5e-10) 32 0.31 SB_3752| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.31 SB_48415| Best HMM Match : Pox_A32 (HMM E-Value=0.014) 31 0.41 SB_45890| Best HMM Match : TMP_2 (HMM E-Value=4.4) 31 0.41 SB_42110| Best HMM Match : Pox_A32 (HMM E-Value=0.034) 31 0.41 SB_25631| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.41 SB_11644| Best HMM Match : Pox_A32 (HMM E-Value=0.026) 31 0.41 SB_10611| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.41 SB_545| Best HMM Match : Pox_A32 (HMM E-Value=0.024) 31 0.41 SB_56578| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.41 SB_45969| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.11) 31 0.41 SB_33050| Best HMM Match : Pox_A32 (HMM E-Value=0.0022) 31 0.41 SB_29316| Best HMM Match : Pox_A32 (HMM E-Value=0.026) 31 0.41 SB_14194| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.41 SB_13305| Best HMM Match : Pox_A32 (HMM E-Value=0.0022) 31 0.41 SB_55513| Best HMM Match : Pox_A32 (HMM E-Value=0.056) 31 0.55 SB_51764| Best HMM Match : Pox_A32 (HMM E-Value=0.025) 31 0.55 SB_51307| Best HMM Match : Pox_A32 (HMM E-Value=0.032) 31 0.55 SB_1075| Best HMM Match : rve (HMM E-Value=0.0089) 31 0.55 SB_52974| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.55 SB_47221| Best HMM Match : Pox_A32 (HMM E-Value=0.04) 31 0.55 SB_34780| Best HMM Match : Pox_A32 (HMM E-Value=0.018) 31 0.55 SB_17484| Best HMM Match : Pox_A32 (HMM E-Value=0.025) 31 0.55 SB_58745| Best HMM Match : rve (HMM E-Value=0.0023) 31 0.72 SB_53158| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.72 SB_18147| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.72 SB_3289| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.72 SB_53547| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.72 SB_48290| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.72 SB_47384| Best HMM Match : Pox_A32 (HMM E-Value=0.029) 31 0.72 SB_44110| Best HMM Match : DUF489 (HMM E-Value=3.3) 31 0.72 SB_40358| Best HMM Match : Pox_A32 (HMM E-Value=0.058) 31 0.72 SB_37603| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) 31 0.72 SB_29824| Best HMM Match : AAA (HMM E-Value=1.1) 31 0.72 SB_23352| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.72 SB_59749| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.95 SB_50164| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.95 SB_45934| Best HMM Match : Gp-FAR-1 (HMM E-Value=2) 30 0.95 SB_43834| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) 30 0.95 SB_39665| Best HMM Match : Pox_A32 (HMM E-Value=0.023) 30 0.95 SB_38421| Best HMM Match : Pox_A32 (HMM E-Value=0.022) 30 0.95 SB_35991| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.88) 30 0.95 SB_35449| Best HMM Match : UPF0154 (HMM E-Value=9.1) 30 0.95 SB_34512| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.95 SB_34068| Best HMM Match : rve (HMM E-Value=5.7e-05) 30 0.95 SB_29336| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.95 SB_27175| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.95 SB_24318| Best HMM Match : Pox_A32 (HMM E-Value=0.029) 30 0.95 SB_24296| Best HMM Match : Pox_A32 (HMM E-Value=1) 30 0.95 SB_21174| Best HMM Match : Pox_A32 (HMM E-Value=0.024) 30 0.95 SB_19215| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.95 SB_16259| Best HMM Match : AAA (HMM E-Value=0.43) 30 0.95 SB_15943| Best HMM Match : Pox_A32 (HMM E-Value=0.027) 30 0.95 SB_12138| Best HMM Match : Pox_A32 (HMM E-Value=0.054) 30 0.95 SB_6357| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.95 SB_2284| Best HMM Match : Hormone_5 (HMM E-Value=0.46) 30 0.95 SB_59561| Best HMM Match : Pox_A32 (HMM E-Value=0.077) 30 0.95 SB_56934| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.95 SB_56091| Best HMM Match : Pox_A32 (HMM E-Value=0.023) 30 0.95 SB_53008| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.95 SB_52465| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.95 SB_46838| Best HMM Match : Gp-FAR-1 (HMM E-Value=1.2) 30 0.95 SB_43038| Best HMM Match : AAA (HMM E-Value=0.84) 30 0.95 SB_37846| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.95 SB_36928| Best HMM Match : Pox_A32 (HMM E-Value=0.022) 30 0.95 SB_36582| Best HMM Match : Pox_A32 (HMM E-Value=0.067) 30 0.95 SB_34580| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.88) 30 0.95 SB_32990| Best HMM Match : Pox_A32 (HMM E-Value=0.023) 30 0.95 SB_23541| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.95 SB_8696| Best HMM Match : Pox_A32 (HMM E-Value=0.16) 30 0.95 SB_8244| Best HMM Match : TMP_2 (HMM E-Value=2.4) 30 0.95 SB_58060| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_48252| Best HMM Match : Ribosomal_60s (HMM E-Value=1.1) 30 1.3 SB_45220| Best HMM Match : Ribosomal_60s (HMM E-Value=0.24) 30 1.3 SB_42859| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_42508| Best HMM Match : Peptidase_U57 (HMM E-Value=4.2) 30 1.3 SB_27971| Best HMM Match : MgtE_N (HMM E-Value=2.8) 30 1.3 SB_15317| Best HMM Match : Pox_A32 (HMM E-Value=0.013) 30 1.3 SB_4600| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_2047| Best HMM Match : Ependymin (HMM E-Value=6e-05) 30 1.3 SB_1433| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_27943| Best HMM Match : Pox_A32 (HMM E-Value=0.047) 30 1.3 SB_16524| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_473| Best HMM Match : Ribosomal_60s (HMM E-Value=0.97) 30 1.3 SB_56959| Best HMM Match : AAA (HMM E-Value=1.5) 29 1.7 SB_52772| Best HMM Match : rve (HMM E-Value=0.001) 29 1.7 SB_51671| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_51578| Best HMM Match : Hormone_5 (HMM E-Value=1.2) 29 1.7 SB_47639| Best HMM Match : Pox_A32 (HMM E-Value=0.075) 29 1.7 SB_44331| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_39944| Best HMM Match : Herpes_UL46 (HMM E-Value=0.8) 29 1.7 SB_36311| Best HMM Match : Pox_A32 (HMM E-Value=0.16) 29 1.7 SB_27884| Best HMM Match : Pox_A32 (HMM E-Value=0.61) 29 1.7 SB_27320| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_27312| Best HMM Match : Pox_A32 (HMM E-Value=0.012) 29 1.7 SB_23010| Best HMM Match : Pox_A32 (HMM E-Value=0.012) 29 1.7 SB_21676| Best HMM Match : TrbF (HMM E-Value=0.99) 29 1.7 SB_5304| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_591| Best HMM Match : AAA (HMM E-Value=1.5) 29 1.7 SB_53187| Best HMM Match : POPLD (HMM E-Value=4.2) 29 1.7 SB_53051| Best HMM Match : rve (HMM E-Value=1.3e-14) 29 1.7 SB_50078| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_43553| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.29) 29 1.7 SB_36025| Best HMM Match : LHC (HMM E-Value=2.9) 29 1.7 SB_33845| Best HMM Match : UPF0154 (HMM E-Value=9.6) 29 1.7 SB_32372| Best HMM Match : rve (HMM E-Value=4.1e-19) 29 1.7 SB_31604| Best HMM Match : Pox_A32 (HMM E-Value=0.019) 29 1.7 SB_29678| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_26624| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_24570| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_2786| Best HMM Match : Pox_A32 (HMM E-Value=0.11) 29 1.7 SB_1754| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_46861| Best HMM Match : Neuralized (HMM E-Value=8.5) 29 2.2 SB_37419| Best HMM Match : Pox_A32 (HMM E-Value=0.24) 29 2.2 SB_25935| Best HMM Match : Pox_A32 (HMM E-Value=0.048) 29 2.2 SB_8164| Best HMM Match : rve (HMM E-Value=0.00069) 29 2.2 SB_3436| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_58553| Best HMM Match : rve (HMM E-Value=0.0011) 29 2.2 SB_23071| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_12072| Best HMM Match : rve (HMM E-Value=2.8e-17) 29 2.2 SB_5898| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_4794| Best HMM Match : Pox_A32 (HMM E-Value=0.085) 29 2.2 SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_59335| Best HMM Match : rve (HMM E-Value=0.0065) 29 2.9 SB_31032| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_23918| Best HMM Match : rve (HMM E-Value=0.013) 29 2.9 SB_5570| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_51434| Best HMM Match : rve (HMM E-Value=0.0029) 29 2.9 SB_33649| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_30354| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_28931| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_27154| Best HMM Match : UPF0154 (HMM E-Value=9.8) 29 2.9 SB_22557| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_18995| Best HMM Match : rve (HMM E-Value=0.0012) 29 2.9 SB_11640| Best HMM Match : Peptidase_C12 (HMM E-Value=3.6) 29 2.9 SB_8786| Best HMM Match : rve (HMM E-Value=0.0029) 29 2.9 SB_3562| Best HMM Match : Ribosomal_60s (HMM E-Value=2.1) 29 2.9 SB_815| Best HMM Match : Ribosomal_60s (HMM E-Value=0.14) 29 2.9 SB_37063| Best HMM Match : Ribosomal_60s (HMM E-Value=0.43) 28 3.8 SB_33101| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_32076| Best HMM Match : Peptidase_A17 (HMM E-Value=0) 28 3.8 SB_25593| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_23459| Best HMM Match : Glyco_hydro_18 (HMM E-Value=0.17) 28 3.8 SB_22647| Best HMM Match : Ribosomal_60s (HMM E-Value=0.43) 28 3.8 SB_16596| Best HMM Match : Pox_A32 (HMM E-Value=0.017) 28 3.8 SB_8388| Best HMM Match : ig (HMM E-Value=8.80001e-41) 28 3.8 SB_25448| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_14410| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_54102| Best HMM Match : Pox_A32 (HMM E-Value=2.6) 28 5.1 SB_49008| Best HMM Match : AAA (HMM E-Value=0.46) 28 5.1 SB_33380| Best HMM Match : Herpes_capsid (HMM E-Value=3) 28 5.1 SB_452| Best HMM Match : RVT_1 (HMM E-Value=9.9e-25) 28 5.1 SB_56634| Best HMM Match : Pox_A32 (HMM E-Value=0.011) 28 5.1 SB_54542| Best HMM Match : Ribosomal_60s (HMM E-Value=0.39) 28 5.1 SB_46989| Best HMM Match : Pox_A32 (HMM E-Value=0.023) 28 5.1 SB_40742| Best HMM Match : Pox_A32 (HMM E-Value=0.042) 28 5.1 SB_22139| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_4086| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_47117| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_26683| Best HMM Match : UPF0154 (HMM E-Value=7.3) 27 6.7 SB_14136| Best HMM Match : Exonuc_X-T (HMM E-Value=6e-25) 27 6.7 SB_28106| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_53159| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_38937| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_36890| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_18844| Best HMM Match : tRNA-synt_1b (HMM E-Value=0) 27 8.9 SB_15432| Best HMM Match : Ribosomal_L10 (HMM E-Value=3.1e-37) 27 8.9 SB_12591| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_51614| Best HMM Match : ROK (HMM E-Value=7) 27 8.9 SB_43987| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_16972| Best HMM Match : Ribosomal_60s (HMM E-Value=0.51) 27 8.9 SB_3898| Best HMM Match : CITED (HMM E-Value=1.5) 27 8.9 >SB_3960| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 762 Score = 104 bits (249), Expect = 5e-23 Identities = 53/109 (48%), Positives = 69/109 (63%), Gaps = 3/109 (2%) Frame = +2 Query: 98 YLLAVLGGKTTPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGREKLSSMP 277 YLLA LG P+A D++ IL SVGIE+D E+L KVI+EL+GK V+++I AG+ KL+++P Sbjct: 656 YLLATLGNNKNPSAKDIKGILDSVGIESDMERLNKVISELSGKSVDEIIQAGKSKLATVP 715 Query: 278 VGGGXXXX---XXXXXXXXXXXEEKKEDXKXXXKXXSESDDDMGFGLFD 415 GG EEKKE+ K + ESDDDMGFGLFD Sbjct: 716 TGGAVAAGGAPAAAAAGGDAKAEEKKEEKK--AESEEESDDDMGFGLFD 762 >SB_41974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 41.1 bits (92), Expect = 5e-04 Identities = 22/51 (43%), Positives = 25/51 (49%) Frame = +2 Query: 263 LSSMPVGGGXXXXXXXXXXXXXXXEEKKEDXKXXXKXXSESDDDMGFGLFD 415 LS+ G G EEKKE+ K + ESDDDMGFGLFD Sbjct: 61 LSAGAPGAGGAVAAAPAAGGEAKAEEKKEEAKKE-ESEEESDDDMGFGLFD 110 >SB_46463| Best HMM Match : Pox_A32 (HMM E-Value=0.04) Length = 235 Score = 37.9 bits (84), Expect = 0.005 Identities = 25/72 (34%), Positives = 36/72 (50%), Gaps = 1/72 (1%) Frame = +2 Query: 29 NVILSALHVSCQLGLKKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEKLKKV 205 N+ SA HV L + +T P R +A L TP+ AD++ IL G E EK+K+ Sbjct: 110 NLAFSARHVGISLWVITSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEKMKEY 169 Query: 206 ITELNGKDVEQL 241 + L K +L Sbjct: 170 MKALKTKKFSKL 181 >SB_58963| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 35.9 bits (79), Expect = 0.019 Identities = 26/71 (36%), Positives = 37/71 (52%), Gaps = 5/71 (7%) Frame = +2 Query: 23 TTNVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADA 187 T N+ LSA HV + + +T P R +A L TP+ AD++ IL G E Sbjct: 66 TLNLALSARHVGISVWVITQQLTSITKPFRENIATLVVFYTPSKADMKAILHDYGAELSE 125 Query: 188 EKLKKVITELN 220 EK+K ++TE N Sbjct: 126 EKMKDLLTENN 136 >SB_47817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 693 Score = 35.5 bits (78), Expect = 0.025 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 1/65 (1%) Frame = +2 Query: 29 NVILSALHVSCQLGLKKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEKLKKV 205 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK+K+ Sbjct: 217 NLAFSARHVGISVWVITSITKPFRENIAALVVFNTPSKADMKAILHDYGAELSEEKMKEY 276 Query: 206 ITELN 220 + L+ Sbjct: 277 MKALS 281 >SB_40686| Best HMM Match : rve (HMM E-Value=0.00016) Length = 1586 Score = 35.5 bits (78), Expect = 0.025 Identities = 22/67 (32%), Positives = 32/67 (47%) Frame = +2 Query: 29 NVILSALHVSCQLGLKKCVTWPRYLLAVLGGKTTPAAADVEKILSSVGIEADAEKLKKVI 208 N+ SA HV+C L R +A L TP+ AD++ IL G E EK+K+ + Sbjct: 873 NLAFSARHVACTQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEKMKEYM 932 Query: 209 TELNGKD 229 K+ Sbjct: 933 KAFKTKN 939 >SB_59010| Best HMM Match : rve (HMM E-Value=0.0052) Length = 935 Score = 35.1 bits (77), Expect = 0.034 Identities = 29/100 (29%), Positives = 44/100 (44%), Gaps = 5/100 (5%) Frame = +2 Query: 2 DLXDVCSTTNVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSS 166 D+ +V+LSA HV + + +T P R +A L TP+ AD++ IL Sbjct: 261 DVAPEAGQIDVLLSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHD 320 Query: 167 VGIEADAEKLKKVITELNGKDVEQLIAAGREKLSSMPVGG 286 G E EK+K+ + L K+ E S+ GG Sbjct: 321 YGAELSEEKMKEYMKALKTKNFSNRTMMSDECFESLLEGG 360 >SB_41374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 33.9 bits (74), Expect = 0.077 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 5/77 (6%) Frame = +2 Query: 26 TNVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAE 190 T+++LSA HV + + +T P R +A L TP+ AD++ IL G E E Sbjct: 437 TDILLSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEE 496 Query: 191 KLKKVITELNGKDVEQL 241 K+K+ + L K +L Sbjct: 497 KMKEYMKALKTKKFSKL 513 >SB_34881| Best HMM Match : DUF1118 (HMM E-Value=2.8) Length = 382 Score = 33.9 bits (74), Expect = 0.077 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 5/77 (6%) Frame = +2 Query: 26 TNVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAE 190 T+++LSA HV + + +T P R +A L TP+ AD++ IL G E E Sbjct: 195 TDILLSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEE 254 Query: 191 KLKKVITELNGKDVEQL 241 K+K+ + L K +L Sbjct: 255 KMKEYMKALKTKKFSKL 271 >SB_10027| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.31) Length = 635 Score = 33.5 bits (73), Expect = 0.10 Identities = 25/76 (32%), Positives = 38/76 (50%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 +++LSA HV + + +T P R +AVL TP AD++ IL G E EK Sbjct: 345 DILLSARHVGISVWVITQQLTSITKPFRENIAVLVDFYTPRKADMKAILHDYGAELSEEK 404 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 405 MKEYMKALKTKKFSKL 420 >SB_2035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 540 Score = 33.5 bits (73), Expect = 0.10 Identities = 29/92 (31%), Positives = 42/92 (45%), Gaps = 5/92 (5%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 11 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGSELSEEK 70 Query: 194 LKKVITELNGKDVEQLIAAGREKLSSMPVGGG 289 +K+ + L K +L R + VGGG Sbjct: 71 MKEYMKALKTKKFSKLEFCLRYPYTIALVGGG 102 >SB_35738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1186 Score = 33.1 bits (72), Expect = 0.14 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 1/75 (1%) Frame = +2 Query: 20 STTNVILSALHVSCQLGLKKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEKL 196 S +V++S ++ QL +T P R +A L TP+ AD++ IL G E EK+ Sbjct: 251 SARHVVISVWVITQQL---TSITKPFRENIAALVVFNTPSKADIKAILHDYGAELSEEKM 307 Query: 197 KKVITELNGKDVEQL 241 K+ + L K +L Sbjct: 308 KEYMKALKTKKFSKL 322 >SB_18915| Best HMM Match : Pox_A32 (HMM E-Value=0.052) Length = 430 Score = 33.1 bits (72), Expect = 0.14 Identities = 25/76 (32%), Positives = 38/76 (50%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGLKK----CVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + + +T P R +A L TP+ AD++ IL G E AEK Sbjct: 260 NLAFSARHVGISVWVIRQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSAEK 319 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 320 MKEYMKALKTKKFSKL 335 >SB_13424| Best HMM Match : Pox_A32 (HMM E-Value=0.073) Length = 1387 Score = 32.7 bits (71), Expect = 0.18 Identities = 25/72 (34%), Positives = 35/72 (48%), Gaps = 1/72 (1%) Frame = +2 Query: 29 NVILSALHVSCQLGLKKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEKLKKV 205 N+ SA HV Q +T P R +A L TP+ AD++ IL G E EK+K+ Sbjct: 1223 NLAFSARHVITQQ--LTSITKPFRENIAALVFFYTPSKADMKAILHDYGAELSEEKMKEY 1280 Query: 206 ITELNGKDVEQL 241 + L K +L Sbjct: 1281 MKALKTKKFSEL 1292 >SB_12028| Best HMM Match : DAG1 (HMM E-Value=0.22) Length = 1249 Score = 32.7 bits (71), Expect = 0.18 Identities = 27/93 (29%), Positives = 38/93 (40%), Gaps = 2/93 (2%) Frame = -2 Query: 387 SDSEXXXXSXXLSSFFSSXXXXXXXXXXXXXXAPPPTGIDDSFSRPAAISC--STSLPLS 214 S S S SS+FSS AP PT S + S STS L+ Sbjct: 738 SQSSIFRTSVLPSSYFSSTVILETSSSSASSLAPSPTATTTSTLQTTEPSSTPSTSPALT 797 Query: 213 SVITFLSFSASASIPTELRIFSTSAAAGVVLPP 115 +T + + S+ PT + ++ A VV+PP Sbjct: 798 VTMTTVIATDSSITPTTVTKVIPTSTATVVIPP 830 >SB_10503| Best HMM Match : Ribosomal_60s (HMM E-Value=0.46) Length = 787 Score = 32.3 bits (70), Expect = 0.24 Identities = 28/90 (31%), Positives = 41/90 (45%), Gaps = 1/90 (1%) Frame = +2 Query: 20 STTNVILSALHVSCQLGLKKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEKL 196 S +V +S L ++ QL +T P R +A L TP+ AD++ IL G E EK+ Sbjct: 525 SARHVGISVLVITQQL---TSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEKM 581 Query: 197 KKVITELNGKDVEQLIAAGREKLSSMPVGG 286 K+ + L K E S+ GG Sbjct: 582 KEYMKALKTKKFSNRTMMSDECFESLLEGG 611 >SB_10435| Best HMM Match : PRAI (HMM E-Value=1.7) Length = 379 Score = 32.3 bits (70), Expect = 0.24 Identities = 25/72 (34%), Positives = 35/72 (48%), Gaps = 1/72 (1%) Frame = +2 Query: 29 NVILSALHVSCQLGLKKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEKLKKV 205 N+ SA HV Q +T P R +A L TP+ AD++ IL G E EK+K+ Sbjct: 92 NLAFSARHVITQQ--LTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEKMKEY 149 Query: 206 ITELNGKDVEQL 241 + L K +L Sbjct: 150 MKALKTKKFSKL 161 >SB_49595| Best HMM Match : POPLD (HMM E-Value=1.1) Length = 1141 Score = 32.3 bits (70), Expect = 0.24 Identities = 24/76 (31%), Positives = 38/76 (50%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 +++LSA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 716 DILLSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 775 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 776 MKEYMNALKTKKFSKL 791 >SB_45055| Best HMM Match : Ribosomal_60s (HMM E-Value=0.46) Length = 741 Score = 32.3 bits (70), Expect = 0.24 Identities = 28/90 (31%), Positives = 41/90 (45%), Gaps = 1/90 (1%) Frame = +2 Query: 20 STTNVILSALHVSCQLGLKKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEKL 196 S +V +S L ++ QL +T P R +A L TP+ AD++ IL G E EK+ Sbjct: 46 SARHVGISVLVITQQL---TSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEKM 102 Query: 197 KKVITELNGKDVEQLIAAGREKLSSMPVGG 286 K+ + L K E S+ GG Sbjct: 103 KEYMKALKTKKFSNRTMMSDECFESLLEGG 132 >SB_42720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2391 Score = 32.3 bits (70), Expect = 0.24 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 1/75 (1%) Frame = +2 Query: 20 STTNVILSALHVSCQLGLKKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEKL 196 S +V +S ++ QL C P R +A L TP+ AD++ IL G E EK+ Sbjct: 1445 SARHVGISVWVITQQLTSITCHHQPFRENIAALVVFYTPSKADMKAILHDYGAELSEEKM 1504 Query: 197 KKVITELNGKDVEQL 241 K+ + +L K +L Sbjct: 1505 KEYMKDLKTKKFSKL 1519 >SB_13336| Best HMM Match : Pox_A32 (HMM E-Value=0.049) Length = 960 Score = 32.3 bits (70), Expect = 0.24 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 5/84 (5%) Frame = +2 Query: 5 LXDVCSTTNVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSV 169 + D C+ + SA HV + + +T P R +A L TP+ AD++ +L Sbjct: 500 ILDDCAASKDAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAVLHDY 559 Query: 170 GIEADAEKLKKVITELNGKDVEQL 241 G E EK+K+ + L K +L Sbjct: 560 GAELSEEKMKEYMNALKTKKFSKL 583 >SB_44641| Best HMM Match : rve (HMM E-Value=1.9e-19) Length = 840 Score = 31.9 bits (69), Expect = 0.31 Identities = 24/76 (31%), Positives = 38/76 (50%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 +++LSA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 73 DILLSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 132 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 133 MKEYMKALKTKKFSKL 148 >SB_56647| Best HMM Match : rve (HMM E-Value=1.5e-10) Length = 1347 Score = 31.9 bits (69), Expect = 0.31 Identities = 30/92 (32%), Positives = 41/92 (44%), Gaps = 7/92 (7%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 508 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 567 Query: 194 LKKVITELNGKDVEQLIAAGRE--KLSSMPVG 283 +K+ + L K L E KL S P G Sbjct: 568 MKEYMKALKTKKFSNLPDRQPEVSKLGSRPSG 599 >SB_3752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1048 Score = 31.9 bits (69), Expect = 0.31 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G+E EK Sbjct: 506 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGVELSEEK 565 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 566 MKEYMKALKTKKFSKL 581 >SB_48415| Best HMM Match : Pox_A32 (HMM E-Value=0.014) Length = 988 Score = 31.5 bits (68), Expect = 0.41 Identities = 27/91 (29%), Positives = 39/91 (42%), Gaps = 5/91 (5%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 518 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 577 Query: 194 LKKVITELNGKDVEQLIAAGREKLSSMPVGG 286 +K+ + L K E S+ GG Sbjct: 578 MKEYMKALKTKKFSNRTMMSDECFESLLEGG 608 >SB_45890| Best HMM Match : TMP_2 (HMM E-Value=4.4) Length = 326 Score = 31.5 bits (68), Expect = 0.41 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 42 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 101 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K+ +L Sbjct: 102 MKEYMKALKTKEFSKL 117 >SB_42110| Best HMM Match : Pox_A32 (HMM E-Value=0.034) Length = 720 Score = 31.5 bits (68), Expect = 0.41 Identities = 27/91 (29%), Positives = 39/91 (42%), Gaps = 5/91 (5%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 235 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 294 Query: 194 LKKVITELNGKDVEQLIAAGREKLSSMPVGG 286 +K+ + L K E S+ GG Sbjct: 295 MKEYMKALKTKKFSNRTMMSDECFESLLEGG 325 >SB_25631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 743 Score = 31.5 bits (68), Expect = 0.41 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 5/79 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 481 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 540 Query: 194 LKKVITELNGKDVEQLIAA 250 +K+ + L K +E + A Sbjct: 541 MKEYMKALKTKKLEFCLPA 559 >SB_11644| Best HMM Match : Pox_A32 (HMM E-Value=0.026) Length = 1532 Score = 31.5 bits (68), Expect = 0.41 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 911 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 970 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K+ +L Sbjct: 971 MKEYMKALKTKEFSKL 986 >SB_10611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1134 Score = 31.5 bits (68), Expect = 0.41 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 110 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSQEK 169 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K+ +L Sbjct: 170 MKEYMKALKTKEFSKL 185 >SB_545| Best HMM Match : Pox_A32 (HMM E-Value=0.024) Length = 454 Score = 31.5 bits (68), Expect = 0.41 Identities = 27/91 (29%), Positives = 39/91 (42%), Gaps = 5/91 (5%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 214 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 273 Query: 194 LKKVITELNGKDVEQLIAAGREKLSSMPVGG 286 +K+ + L K E S+ GG Sbjct: 274 MKEYMKALKTKKFSNRTMMSDECFESLLEGG 304 >SB_56578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1033 Score = 31.5 bits (68), Expect = 0.41 Identities = 25/76 (32%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 405 NLAFSARHVDISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 464 Query: 194 LKKVITELNGKDVEQL 241 +K+ I L K +L Sbjct: 465 MKEYIKALKTKKFSKL 480 >SB_45969| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.11) Length = 735 Score = 31.5 bits (68), Expect = 0.41 Identities = 25/76 (32%), Positives = 37/76 (48%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ LSA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 446 NLALSARHVGISVWVITQQLTSITKPFRENIATLVVFYTPSKADMKAILHDYGAELSEEK 505 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 506 MKEYMKALKTKRFSKL 521 >SB_33050| Best HMM Match : Pox_A32 (HMM E-Value=0.0022) Length = 560 Score = 31.5 bits (68), Expect = 0.41 Identities = 25/76 (32%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + L +T P R +A L TP+ AD++ IL G E EK Sbjct: 344 NLAFSARHVGISVWLITQQLTSITKPFRENIAALVVFYTPSKADMKTILHDYGAELSEEK 403 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 404 MKEYMKALKTKKFSKL 419 >SB_29316| Best HMM Match : Pox_A32 (HMM E-Value=0.026) Length = 288 Score = 31.5 bits (68), Expect = 0.41 Identities = 25/76 (32%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 110 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 169 Query: 194 LKKVITELNGKDVEQL 241 +K+ I L K +L Sbjct: 170 MKEYIKALKTKKFSKL 185 >SB_14194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1198 Score = 31.5 bits (68), Expect = 0.41 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL+ G E EK Sbjct: 517 NLAFSARHVGISVWVITQQLTSITKPFRESIAALVVFYTPSKADMKAILNDYGAELSEEK 576 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 577 MKEYMKALKTKKFSKL 592 >SB_13305| Best HMM Match : Pox_A32 (HMM E-Value=0.0022) Length = 578 Score = 31.5 bits (68), Expect = 0.41 Identities = 25/76 (32%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + L +T P R +A L TP+ AD++ IL G E EK Sbjct: 362 NLAFSARHVGISVWLITQQLTSITKPFRENIAALVVFYTPSKADMKTILHDYGAELSEEK 421 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 422 MKEYMKALKTKKFSKL 437 >SB_55513| Best HMM Match : Pox_A32 (HMM E-Value=0.056) Length = 937 Score = 31.1 bits (67), Expect = 0.55 Identities = 25/76 (32%), Positives = 38/76 (50%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVS-CQLGLKK---CVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV C + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 583 NLAFSARHVGICVWVITQQLTSITKPFRENIAALVVFYTPSEADMKAILHDYGAELSEEK 642 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K+ +L Sbjct: 643 MKEYMKALKTKEFSKL 658 >SB_51764| Best HMM Match : Pox_A32 (HMM E-Value=0.025) Length = 812 Score = 31.1 bits (67), Expect = 0.55 Identities = 27/89 (30%), Positives = 40/89 (44%), Gaps = 5/89 (5%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 477 NLAFSARHVGISVWVITQQLTSITKPFREDIAALVVFYTPSKADMKAILHDYGAELSEEK 536 Query: 194 LKKVITELNGKDVEQLIAAGREKLSSMPV 280 +K+ + L K +L R + PV Sbjct: 537 MKEYMKALKTKKFSKLEFCLRHPYTIAPV 565 >SB_51307| Best HMM Match : Pox_A32 (HMM E-Value=0.032) Length = 1036 Score = 31.1 bits (67), Expect = 0.55 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 946 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVSYTPSKADMKAILHDYGAELSEEK 1005 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 1006 MKEYMKVLKTKKFSKL 1021 >SB_1075| Best HMM Match : rve (HMM E-Value=0.0089) Length = 1617 Score = 31.1 bits (67), Expect = 0.55 Identities = 25/76 (32%), Positives = 38/76 (50%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVS-CQLGLKK---CVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV C + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 839 NLAFSARHVGICVWVITQQLTSITKPFRENIAALVVFYTPSEADMKAILHDYGAELSEEK 898 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K+ +L Sbjct: 899 MKEYMKALKTKEFSKL 914 >SB_52974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 660 Score = 31.1 bits (67), Expect = 0.55 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIA 247 TP+ AD++ IL G E EK+K+ + L K + IA Sbjct: 148 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKFIA 187 >SB_47221| Best HMM Match : Pox_A32 (HMM E-Value=0.04) Length = 263 Score = 31.1 bits (67), Expect = 0.55 Identities = 27/91 (29%), Positives = 38/91 (41%), Gaps = 5/91 (5%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 110 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 169 Query: 194 LKKVITELNGKDVEQLIAAGREKLSSMPVGG 286 +K+ L K E S+ GG Sbjct: 170 MKEYTKALKTKKFSNRTMMSDEYFESLLEGG 200 >SB_34780| Best HMM Match : Pox_A32 (HMM E-Value=0.018) Length = 625 Score = 31.1 bits (67), Expect = 0.55 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 226 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFNTPSKADMKAILHDYGAELSEEK 285 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 286 MKEYMKALKTKKFSKL 301 >SB_17484| Best HMM Match : Pox_A32 (HMM E-Value=0.025) Length = 1616 Score = 31.1 bits (67), Expect = 0.55 Identities = 27/89 (30%), Positives = 40/89 (44%), Gaps = 5/89 (5%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 894 NLAFSARHVGISVWVITQQLTSITKPFREDIAALVVFYTPSKADMKAILHDYGAELSEEK 953 Query: 194 LKKVITELNGKDVEQLIAAGREKLSSMPV 280 +K+ + L K +L R + PV Sbjct: 954 MKEYMKALKTKKFSKLEFCLRHPYTIAPV 982 >SB_58745| Best HMM Match : rve (HMM E-Value=0.0023) Length = 943 Score = 30.7 bits (66), Expect = 0.72 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 422 NLAFSACHVGISVWVITQQLTSITKPFRENIATLVVFYTPSKADMKAILHDYGAELSEEK 481 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 482 MKEYMKALKTKKFSKL 497 >SB_53158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 30.7 bits (66), Expect = 0.72 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 1/75 (1%) Frame = +2 Query: 20 STTNVILSALHVSCQLGLKKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEKL 196 S +V +S L ++ QL +T P R +A L TP+ AD++ IL G E EK+ Sbjct: 114 SARHVGISVLMITQQL---TSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEKM 170 Query: 197 KKVITELNGKDVEQL 241 K+ L K +L Sbjct: 171 KEYTKALKTKKFSKL 185 >SB_18147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 30.7 bits (66), Expect = 0.72 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ I L K +L Sbjct: 28 TPSKADMKAILHDYGAELSEEKMKEYIKALKTKKFSKL 65 >SB_3289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 500 Score = 30.7 bits (66), Expect = 0.72 Identities = 27/91 (29%), Positives = 40/91 (43%), Gaps = 5/91 (5%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 410 NLAFSARHVGISVWVITQHLTSITKPFRDNIAALVVFYTPSKADMKAILHDYGAEVSEEK 469 Query: 194 LKKVITELNGKDVEQLIAAGREKLSSMPVGG 286 +K+ + L K +L R + V G Sbjct: 470 MKEYMKALKTKKFSKLEFCSRHPYTIALVEG 500 >SB_53547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1381 Score = 30.7 bits (66), Expect = 0.72 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +2 Query: 83 VTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 +T P R +A L TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 1328 ITKPFRENIAALVVNYTPSKADMKAILHDYGAELSEEKMKEYMKALKKKKFSKL 1381 >SB_48290| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 652 Score = 30.7 bits (66), Expect = 0.72 Identities = 24/76 (31%), Positives = 38/76 (50%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV ++ + +T P R +A L TP+ AD++ IL + G E EK Sbjct: 411 NLAFSARHVGIRVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHAYGAELSEEK 470 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 471 MKEYMKALKTKKFPKL 486 >SB_47384| Best HMM Match : Pox_A32 (HMM E-Value=0.029) Length = 327 Score = 30.7 bits (66), Expect = 0.72 Identities = 28/92 (30%), Positives = 39/92 (42%), Gaps = 5/92 (5%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 110 NLAFSARHVGISVWVITQQLTSITKPFRENIAALEVFYTPSKADMKAILHDYGAELSEEK 169 Query: 194 LKKVITELNGKDVEQLIAAGREKLSSMPVGGG 289 +K+ + L K E S GGG Sbjct: 170 MKESMKALKTKKFLNRTMMCDECFESFLEGGG 201 >SB_44110| Best HMM Match : DUF489 (HMM E-Value=3.3) Length = 491 Score = 30.7 bits (66), Expect = 0.72 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGK 226 TP+ AD++ IL G E EK+K+ + LN K Sbjct: 447 TPSKADMKAILHDYGAELSEEKMKEYMKALNTK 479 >SB_40358| Best HMM Match : Pox_A32 (HMM E-Value=0.058) Length = 874 Score = 30.7 bits (66), Expect = 0.72 Identities = 26/91 (28%), Positives = 39/91 (42%), Gaps = 5/91 (5%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 385 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 444 Query: 194 LKKVITELNGKDVEQLIAAGREKLSSMPVGG 286 +K+ + L K + S+ GG Sbjct: 445 MKEYMKALKTKKFSNRTMMSDDYFESLLEGG 475 >SB_37603| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) Length = 1411 Score = 30.7 bits (66), Expect = 0.72 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 902 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 961 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 962 MKEYMNALKTKKFSKL 977 >SB_29824| Best HMM Match : AAA (HMM E-Value=1.1) Length = 163 Score = 30.7 bits (66), Expect = 0.72 Identities = 24/76 (31%), Positives = 38/76 (50%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 +V+LSA HV + + +T P R +A L TP+ AD++ IL G EK Sbjct: 73 DVLLSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAGLSEEK 132 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K+ +L Sbjct: 133 MKEYMKALKTKEFSKL 148 >SB_23352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1830 Score = 30.7 bits (66), Expect = 0.72 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 495 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSGEK 554 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 555 MKEYMKALKTKKFSKL 570 >SB_59749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1091 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 513 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 572 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 573 MKEYMKALKTKKFSKL 588 >SB_50164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1780 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 1509 NLAFSARHVGISVWVITQQVTSITKPFRENIAALVVFYTPSRADMKAILHDYGAELSEEK 1568 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 1569 MKEYMKALKTKKFSKL 1584 >SB_45934| Best HMM Match : Gp-FAR-1 (HMM E-Value=2) Length = 694 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L +P+ AD+E IL G E EK Sbjct: 502 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYSPSKADMEAILHDYGAELSEEK 561 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 562 MKECMKALKTKKFSKL 577 >SB_43834| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) Length = 1227 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 651 NLAFSARHVGVSVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 710 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 711 MKEYMKALKTKKFSKL 726 >SB_39665| Best HMM Match : Pox_A32 (HMM E-Value=0.023) Length = 1640 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 1008 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 1067 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 1068 IKEYMKALKTKKFSKL 1083 >SB_38421| Best HMM Match : Pox_A32 (HMM E-Value=0.022) Length = 1144 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 498 NLAFSARHVGISVWVITQQLTSITKPFRENIAALMVFYTPSKADMKAILHDYGAELSKEK 557 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 558 MKEYMKALKTKKFSKL 573 >SB_35991| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.88) Length = 669 Score = 30.3 bits (65), Expect = 0.95 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K+ +L Sbjct: 210 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKNFSKL 247 >SB_35449| Best HMM Match : UPF0154 (HMM E-Value=9.1) Length = 101 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 11 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSRADMKAILHDYGAELSEEK 70 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 71 MKEYMKALKTKKFSKL 86 >SB_34512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1080 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 374 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 433 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 434 MKEYMKALKTKKFSKL 449 >SB_34068| Best HMM Match : rve (HMM E-Value=5.7e-05) Length = 1081 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 333 NLTFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 392 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 393 MKEYMKALKTKKFSKL 408 >SB_29336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1047 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 510 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSRADMKAILHDYGAELSEEK 569 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 570 MKEYMKALKTKKFSKL 585 >SB_27175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1720 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 1159 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 1218 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 1219 MKEYMKALKTKKFSKL 1234 >SB_24318| Best HMM Match : Pox_A32 (HMM E-Value=0.029) Length = 598 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 508 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 567 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 568 MKEYMKALKTKKFSKL 583 >SB_24296| Best HMM Match : Pox_A32 (HMM E-Value=1) Length = 1041 Score = 30.3 bits (65), Expect = 0.95 Identities = 25/76 (32%), Positives = 35/76 (46%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV L + VT P R +A L TP+ AD++ IL G E EK Sbjct: 951 NLAFSARHVGISLWVITQQLTSVTKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 1010 Query: 194 LKKVITELNGKDVEQL 241 +K+ + K +L Sbjct: 1011 MKEYMKAFKTKKFSKL 1026 >SB_21174| Best HMM Match : Pox_A32 (HMM E-Value=0.024) Length = 702 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 388 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 447 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 448 MKEYMKALKTKKFSKL 463 >SB_19215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1096 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 508 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 567 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 568 MKEYMKALKTKKFSKL 583 >SB_16259| Best HMM Match : AAA (HMM E-Value=0.43) Length = 538 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 388 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 447 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 448 MKEYMKALKTKKFSKL 463 >SB_15943| Best HMM Match : Pox_A32 (HMM E-Value=0.027) Length = 804 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 378 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 437 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 438 MKEYMKALKTKKFSKL 453 >SB_12138| Best HMM Match : Pox_A32 (HMM E-Value=0.054) Length = 409 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 110 NLAFSARHVGISVWVITKQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 169 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 170 MKEYMKALKTKKFSKL 185 >SB_6357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1650 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 949 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 1008 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 1009 MKEYMKALKTKKFSKL 1024 >SB_2284| Best HMM Match : Hormone_5 (HMM E-Value=0.46) Length = 1266 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 454 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 513 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 514 MKEYMKALKTKKFSKL 529 >SB_59561| Best HMM Match : Pox_A32 (HMM E-Value=0.077) Length = 986 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 378 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 437 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 438 MKEYMKALKTKKFSKL 453 >SB_56934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2541 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 1664 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKTILHDYGAELSEEK 1723 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 1724 MKEYMKALKTKKFSKL 1739 >SB_56091| Best HMM Match : Pox_A32 (HMM E-Value=0.023) Length = 914 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 466 NLAFSARHVGISVWVITQQLTSITKPFRENIAALMVFYTPSKADMKAILHDYGAELSKEK 525 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 526 MKEYMKALKTKKFSKL 541 >SB_53008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 507 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 110 NLTFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 169 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 170 MKEYMKALKTKKFSKL 185 >SB_52465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 30.3 bits (65), Expect = 0.95 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ I L K +L Sbjct: 146 TPSKADMKAILHDYGAELPEEKMKEYIKALKTKKFSKL 183 >SB_46838| Best HMM Match : Gp-FAR-1 (HMM E-Value=1.2) Length = 512 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 11 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 70 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 71 MKEYMKALKTKKFSKL 86 >SB_43038| Best HMM Match : AAA (HMM E-Value=0.84) Length = 957 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 513 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 572 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 573 MKEYMKALKTKKFSKL 588 >SB_37846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 56 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 115 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 116 MKEYMKALKTKKFSKL 131 >SB_36928| Best HMM Match : Pox_A32 (HMM E-Value=0.022) Length = 496 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 110 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKTILHDYGAELSEEK 169 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 170 MKEYMKALKTKKFSKL 185 >SB_36582| Best HMM Match : Pox_A32 (HMM E-Value=0.067) Length = 367 Score = 30.3 bits (65), Expect = 0.95 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ I L K +L Sbjct: 146 TPSKADMKAILHDYGAELPEEKMKEYIKALKTKKFSKL 183 >SB_34580| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.88) Length = 953 Score = 30.3 bits (65), Expect = 0.95 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K+ +L Sbjct: 410 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKNFSKL 447 >SB_32990| Best HMM Match : Pox_A32 (HMM E-Value=0.023) Length = 594 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 320 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 379 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 380 IKEYMKALKTKKFSKL 395 >SB_23541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 957 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD + IL G E EK Sbjct: 506 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADKKAILHDYGAELSEEK 565 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K+ +L Sbjct: 566 MKEYMKALKTKEFSKL 581 >SB_8696| Best HMM Match : Pox_A32 (HMM E-Value=0.16) Length = 1152 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 470 NLAFSARHVGISVWVITQQVTSITKPFRENIAALVVFYTPSRADMKAILHDYGAELSEEK 529 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 530 MKEYMKALKTKKFSKL 545 >SB_8244| Best HMM Match : TMP_2 (HMM E-Value=2.4) Length = 259 Score = 30.3 bits (65), Expect = 0.95 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 58 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 117 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 118 MKEYMKALKTKKFSKL 133 >SB_58060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 863 Score = 29.9 bits (64), Expect = 1.3 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 110 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 169 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 170 MKEYMKALKTKRFSKL 185 >SB_48252| Best HMM Match : Ribosomal_60s (HMM E-Value=1.1) Length = 937 Score = 29.9 bits (64), Expect = 1.3 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 359 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 418 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 419 MKEYMKALKTKRFSKL 434 >SB_45220| Best HMM Match : Ribosomal_60s (HMM E-Value=0.24) Length = 362 Score = 29.9 bits (64), Expect = 1.3 Identities = 23/76 (30%), Positives = 37/76 (48%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 86 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 145 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K+ + + Sbjct: 146 MKEYMKALKTKNHDMM 161 >SB_42859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1370 Score = 29.9 bits (64), Expect = 1.3 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 1078 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 1137 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 1138 MKECMKALKTKRFSKL 1153 >SB_42508| Best HMM Match : Peptidase_U57 (HMM E-Value=4.2) Length = 703 Score = 29.9 bits (64), Expect = 1.3 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGLKK----CVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 368 NLAFSARHVGISVWVITQQITSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 427 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 428 MKEYMKALKTKKFSKL 443 >SB_27971| Best HMM Match : MgtE_N (HMM E-Value=2.8) Length = 235 Score = 29.9 bits (64), Expect = 1.3 Identities = 18/40 (45%), Positives = 27/40 (67%) Frame = +2 Query: 137 AADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGR 256 AADV+K+++S G AD +KL I DV++LIA+G+ Sbjct: 9 AADVDKLIAS-GKAADVDKL---IASGKAADVDKLIASGK 44 Score = 29.9 bits (64), Expect = 1.3 Identities = 18/40 (45%), Positives = 27/40 (67%) Frame = +2 Query: 137 AADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGR 256 AADV+K+++S G AD +KL I DV++LIA+G+ Sbjct: 21 AADVDKLIAS-GKAADVDKL---IASGKAADVDKLIASGK 56 Score = 29.9 bits (64), Expect = 1.3 Identities = 18/40 (45%), Positives = 27/40 (67%) Frame = +2 Query: 137 AADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGR 256 AADV+K+++S G AD +KL I DV++LIA+G+ Sbjct: 33 AADVDKLIAS-GKAADVDKL---IASGKAADVDKLIASGK 68 Score = 29.9 bits (64), Expect = 1.3 Identities = 18/40 (45%), Positives = 27/40 (67%) Frame = +2 Query: 137 AADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGR 256 AADV+K+++S G AD +KL I DV++LIA+G+ Sbjct: 45 AADVDKLIAS-GKAADVDKL---IASGKAADVDKLIASGK 80 Score = 27.9 bits (59), Expect = 5.1 Identities = 16/40 (40%), Positives = 25/40 (62%) Frame = +2 Query: 137 AADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGR 256 AADV+K+++S A L K+I DV++LIA+G+ Sbjct: 105 AADVDKLIAS----GKAGDLDKLIASGKAADVDKLIASGK 140 Score = 27.1 bits (57), Expect = 8.9 Identities = 17/40 (42%), Positives = 26/40 (65%) Frame = +2 Query: 137 AADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGR 256 AAD +K+++S G AD +KL I DV++LIA+G+ Sbjct: 81 AADGDKLIAS-GKAADVDKL---IASGKAADVDKLIASGK 116 >SB_15317| Best HMM Match : Pox_A32 (HMM E-Value=0.013) Length = 1124 Score = 29.9 bits (64), Expect = 1.3 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 467 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 526 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 527 MKEYMKALKTKRFSKL 542 >SB_4600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1140 Score = 29.9 bits (64), Expect = 1.3 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 5/73 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 628 NLAFSARHVGISVWVITQQLTSITKPFRDNIAALVVFYTPSKADMKAILHDYGAELSEEK 687 Query: 194 LKKVITELNGKDV 232 +K+ + L K V Sbjct: 688 MKEYMKALKTKKV 700 >SB_2047| Best HMM Match : Ependymin (HMM E-Value=6e-05) Length = 739 Score = 29.9 bits (64), Expect = 1.3 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 110 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVIFYTPSKADMKAILHDYGAELSEEK 169 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 170 MKEYMKALKTKKFSKL 185 >SB_1433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1096 Score = 29.9 bits (64), Expect = 1.3 Identities = 24/76 (31%), Positives = 35/76 (46%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD+ IL G E EK Sbjct: 510 NLAFSARHVGISVWVITQQLTSITKPYRENIAALVVFYTPSKADMRAILHDYGAELSEEK 569 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 570 MKEYMKALKTKKFSKL 585 >SB_27943| Best HMM Match : Pox_A32 (HMM E-Value=0.047) Length = 983 Score = 29.9 bits (64), Expect = 1.3 Identities = 17/53 (32%), Positives = 23/53 (43%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGREKLSSMPVGG 286 TP+ AD++ IL G E EK+K+ + L K E S GG Sbjct: 447 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSNRTMMSDECFESFLEGG 499 >SB_16524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 825 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 616 TPSKADMKAILQDYGAELSEEKMKEYMRALKTKKFSKL 653 >SB_473| Best HMM Match : Ribosomal_60s (HMM E-Value=0.97) Length = 757 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 472 TPSKADMKAILHDYGAELSEEKMKQYMKALKTKQFSKL 509 >SB_56959| Best HMM Match : AAA (HMM E-Value=1.5) Length = 189 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 138 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 175 >SB_52772| Best HMM Match : rve (HMM E-Value=0.001) Length = 646 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 238 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 275 >SB_51671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 665 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 429 TPSKADMKAILHDYGAELSKEKMKEYMKALKTKKFSKL 466 >SB_51578| Best HMM Match : Hormone_5 (HMM E-Value=1.2) Length = 622 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 35 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 72 >SB_47639| Best HMM Match : Pox_A32 (HMM E-Value=0.075) Length = 911 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 304 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 341 >SB_44331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1916 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 1373 TPSKADMKAILHDYGAELSEEKMKEYMKTLKTKKFSKL 1410 >SB_39944| Best HMM Match : Herpes_UL46 (HMM E-Value=0.8) Length = 636 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 146 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 183 >SB_36311| Best HMM Match : Pox_A32 (HMM E-Value=0.16) Length = 869 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 343 TPSKADMKAILHDYGAELSEEKIKEYMKALKTKKFSKL 380 >SB_27884| Best HMM Match : Pox_A32 (HMM E-Value=0.61) Length = 1226 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 1043 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 1080 >SB_27320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 721 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 467 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 504 >SB_27312| Best HMM Match : Pox_A32 (HMM E-Value=0.012) Length = 1115 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 288 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 325 >SB_23010| Best HMM Match : Pox_A32 (HMM E-Value=0.012) Length = 776 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 556 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 593 >SB_21676| Best HMM Match : TrbF (HMM E-Value=0.99) Length = 681 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K + +L Sbjct: 88 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKMLSKL 125 >SB_5304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 29.5 bits (63), Expect = 1.7 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 11 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAERSEEK 70 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 71 MKEHMKALKTKKFSKL 86 >SB_591| Best HMM Match : AAA (HMM E-Value=1.5) Length = 542 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 490 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 527 >SB_53187| Best HMM Match : POPLD (HMM E-Value=4.2) Length = 344 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 292 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 329 >SB_53051| Best HMM Match : rve (HMM E-Value=1.3e-14) Length = 1624 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 870 TPSKADMKAILHDYGAELSEEKMKECMKALKTKKFSKL 907 >SB_50078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 394 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 132 TPSKADMKAILHDYGTELSEEKIKEYMEALKKKKFSKL 169 >SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2973 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 751 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 788 >SB_43553| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.29) Length = 1851 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 1220 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 1257 >SB_36025| Best HMM Match : LHC (HMM E-Value=2.9) Length = 671 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 289 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 326 >SB_33845| Best HMM Match : UPF0154 (HMM E-Value=9.6) Length = 132 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 80 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 117 >SB_32372| Best HMM Match : rve (HMM E-Value=4.1e-19) Length = 1562 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 1134 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 1171 >SB_31604| Best HMM Match : Pox_A32 (HMM E-Value=0.019) Length = 802 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 576 TPSKADMKAILHDYGAELSEEKMKEYMKTLKTKKFSKL 613 >SB_29678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 851 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 393 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 430 >SB_26624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 148 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 185 >SB_24570| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 502 Score = 29.5 bits (63), Expect = 1.7 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +2 Query: 83 VTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 +T P R +A L TP+ AD++ IL G E +K+K+ + L K +L Sbjct: 438 ITKPFRENIAALVAFYTPSKADMKAILHDYGAELSEDKMKEYMKALKTKKFSKL 491 >SB_2786| Best HMM Match : Pox_A32 (HMM E-Value=0.11) Length = 1182 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 982 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 1019 >SB_1754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1521 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 1137 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 1174 >SB_46861| Best HMM Match : Neuralized (HMM E-Value=8.5) Length = 217 Score = 29.1 bits (62), Expect = 2.2 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 5/71 (7%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 127 NLAFSARHVGISVWVITQQLTSITKPSRENIAALVVFYTPSKADMKAILHDYGAELSEEK 186 Query: 194 LKKVITELNGK 226 +K+ + L K Sbjct: 187 MKEYMKALKTK 197 >SB_37419| Best HMM Match : Pox_A32 (HMM E-Value=0.24) Length = 1497 Score = 29.1 bits (62), Expect = 2.2 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 1103 TPSKADMKAILHDYGAEFSEEKMKEYMKALKTKKFSKL 1140 >SB_25935| Best HMM Match : Pox_A32 (HMM E-Value=0.048) Length = 310 Score = 29.1 bits (62), Expect = 2.2 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 5/71 (7%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 236 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 295 Query: 194 LKKVITELNGK 226 +K+ + L K Sbjct: 296 MKEYMKALKTK 306 >SB_8164| Best HMM Match : rve (HMM E-Value=0.00069) Length = 1117 Score = 29.1 bits (62), Expect = 2.2 Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 5/73 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E K Sbjct: 337 NLAFSARHVGISVWMITQQLTSITKPFRENIAALVVSYTPSKADIKAILHDYGAELSEGK 396 Query: 194 LKKVITELNGKDV 232 +K+ + L ++V Sbjct: 397 MKEYMKALQVEEV 409 >SB_3436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.1 bits (62), Expect = 2.2 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ L G E EK+K+ + L K+ +L Sbjct: 75 TPSKADMKAFLHDYGAELSEEKMKEYMKALKTKEFSKL 112 >SB_58553| Best HMM Match : rve (HMM E-Value=0.0011) Length = 1745 Score = 29.1 bits (62), Expect = 2.2 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGREKLSSMPVGG 286 TP+ AD++ IL G E EK+K+ + L + E S+ GG Sbjct: 882 TPSKADMKAILHDYGAELSEEKMKEYMKALKTEKFSNRTMMSDECFESLLEGG 934 >SB_23071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1208 Score = 29.1 bits (62), Expect = 2.2 Identities = 22/71 (30%), Positives = 34/71 (47%), Gaps = 5/71 (7%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ +L G E EK Sbjct: 471 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAVLHDYGAELSEEK 530 Query: 194 LKKVITELNGK 226 +K+ + L K Sbjct: 531 MKEYMNALKTK 541 >SB_12072| Best HMM Match : rve (HMM E-Value=2.8e-17) Length = 1693 Score = 29.1 bits (62), Expect = 2.2 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 965 NLAFSARHVGISVWVITQQLTSITKPFREDIAALVVFYTPSKADMKAILHDYGSELSEEK 1024 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 1025 MKEYMKALKMKKFSKL 1040 >SB_5898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1109 Score = 29.1 bits (62), Expect = 2.2 Identities = 25/90 (27%), Positives = 38/90 (42%), Gaps = 5/90 (5%) Frame = +2 Query: 29 NVILSALHVSCQLGLKK----CVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ +L G E EK Sbjct: 473 NLAFSARHVGISVWVITQQFTSITKPFRENIAALVVFYTPSKADMKAVLHDYGAELSEEK 532 Query: 194 LKKVITELNGKDVEQLIAAGREKLSSMPVG 283 +K+ + L K E S+ G Sbjct: 533 MKEYMKALKTKKFSNRTMMSEECFESLLEG 562 >SB_4794| Best HMM Match : Pox_A32 (HMM E-Value=0.085) Length = 369 Score = 29.1 bits (62), Expect = 2.2 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 5/71 (7%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 295 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 354 Query: 194 LKKVITELNGK 226 +K+ + L K Sbjct: 355 MKEYMKALKTK 365 >SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2342 Score = 29.1 bits (62), Expect = 2.2 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ +L G E EK+K+ + L K +L Sbjct: 1855 TPSKADMKAVLHDYGAELSEEKMKEYMKALKTKKFSKL 1892 >SB_59335| Best HMM Match : rve (HMM E-Value=0.0065) Length = 1020 Score = 28.7 bits (61), Expect = 2.9 Identities = 23/76 (30%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E +K Sbjct: 297 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEKK 356 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 357 MKEYMKALKTKKFSKL 372 >SB_31032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1008 Score = 28.7 bits (61), Expect = 2.9 Identities = 24/71 (33%), Positives = 34/71 (47%), Gaps = 5/71 (7%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV L + +T P R +A L TP+ AD++ IL G E EK Sbjct: 523 NLAFSARHVGISLWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELLEEK 582 Query: 194 LKKVITELNGK 226 +K+ + L K Sbjct: 583 MKEYMKALKTK 593 >SB_23918| Best HMM Match : rve (HMM E-Value=0.013) Length = 1785 Score = 28.7 bits (61), Expect = 2.9 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD+ IL G E EK+K+ + L K +L Sbjct: 909 TPSKADINVILHDYGAELSEEKMKENMKALKTKKFSKL 946 >SB_5570| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 332 Score = 28.7 bits (61), Expect = 2.9 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 110 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 169 Query: 194 LKKVITELNGKDVEQL 241 +K+ + K +L Sbjct: 170 MKEYMKAFKTKKFSKL 185 >SB_51434| Best HMM Match : rve (HMM E-Value=0.0029) Length = 748 Score = 28.7 bits (61), Expect = 2.9 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 5/71 (7%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 335 NLAFSARHVCISVWVIAQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 394 Query: 194 LKKVITELNGK 226 +K+ + L K Sbjct: 395 IKEYMKALKTK 405 >SB_33649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 723 Score = 28.7 bits (61), Expect = 2.9 Identities = 23/76 (30%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G + EK Sbjct: 321 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAKLSEEK 380 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 381 MKEYMKALKTKKFSKL 396 >SB_30354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 28.7 bits (61), Expect = 2.9 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV ++ + +T P R +A + TP+ AD++ IL G E +K Sbjct: 318 NLAFSARHVGIRMWVITQQLTSITKPFRENIAAMVVFYTPSKADMKAILHDYGAELSEKK 377 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 378 MKEYMKALKTKKFSKL 393 >SB_28931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1035 Score = 28.7 bits (61), Expect = 2.9 Identities = 23/76 (30%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E +K Sbjct: 92 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEKK 151 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 152 MKEYLKGLKTKKFSKL 167 >SB_27154| Best HMM Match : UPF0154 (HMM E-Value=9.8) Length = 89 Score = 28.7 bits (61), Expect = 2.9 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +2 Query: 83 VTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 +T P R +A L TP+ AD++ L G E EK+K+ + L K +L Sbjct: 21 ITKPFRETIAALVVFYTPSKADMKAFLHDYGAELSEEKMKECMKALKTKKFSKL 74 >SB_22557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 656 Score = 28.7 bits (61), Expect = 2.9 Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 5/63 (7%) Frame = +2 Query: 26 TNVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAE 190 TN+ SA HV + + +T P R +A L TP+ AD++ IL G E E Sbjct: 102 TNLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEE 161 Query: 191 KLK 199 K+K Sbjct: 162 KMK 164 >SB_18995| Best HMM Match : rve (HMM E-Value=0.0012) Length = 1225 Score = 28.7 bits (61), Expect = 2.9 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVI 208 TP+ AD++ IL G+E EK+K+ + Sbjct: 416 TPSKADMKAILHDYGVELSEEKMKEAL 442 >SB_11640| Best HMM Match : Peptidase_C12 (HMM E-Value=3.6) Length = 839 Score = 28.7 bits (61), Expect = 2.9 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +2 Query: 83 VTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 +T P R +A L TP+ AD++ L G E EK+K+ + L K +L Sbjct: 578 ITKPFRETIAALVVFYTPSKADMKAFLHDYGAELSEEKMKECMKALKTKKFSKL 631 >SB_8786| Best HMM Match : rve (HMM E-Value=0.0029) Length = 946 Score = 28.7 bits (61), Expect = 2.9 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 5/71 (7%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 546 NLAFSARHVCISVWVIAQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 605 Query: 194 LKKVITELNGK 226 +K+ + L K Sbjct: 606 IKEYMKALKTK 616 >SB_3562| Best HMM Match : Ribosomal_60s (HMM E-Value=2.1) Length = 254 Score = 28.7 bits (61), Expect = 2.9 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKD 229 TP+ AD++ IL G E EK+K+ + L K+ Sbjct: 21 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKN 54 >SB_815| Best HMM Match : Ribosomal_60s (HMM E-Value=0.14) Length = 443 Score = 28.7 bits (61), Expect = 2.9 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 5/71 (7%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 212 NLAFSARHVCISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 271 Query: 194 LKKVITELNGK 226 +K+ + L K Sbjct: 272 MKEYMKALETK 282 >SB_37063| Best HMM Match : Ribosomal_60s (HMM E-Value=0.43) Length = 462 Score = 28.3 bits (60), Expect = 3.8 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ D++ IL G E EK Sbjct: 26 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKEDMKAILHDYGAELSEEK 85 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 86 MKEYMEALKKKKFSKL 101 >SB_33101| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 394 Score = 28.3 bits (60), Expect = 3.8 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K + L K +L Sbjct: 342 TPSKADMKAILHDYGAELSEEKMKVYMKALKTKKFSKL 379 >SB_32076| Best HMM Match : Peptidase_A17 (HMM E-Value=0) Length = 2352 Score = 28.3 bits (60), Expect = 3.8 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGK 226 TP+ AD++ IL G E EK+K+ + L K Sbjct: 1835 TPSKADMKAILHDYGAELSEEKMKEYMKALKTK 1867 >SB_25593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 746 Score = 28.3 bits (60), Expect = 3.8 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 315 TPSKADMKAILHDYGPELSDEKMKEYMKALKTKKFSKL 352 >SB_23459| Best HMM Match : Glyco_hydro_18 (HMM E-Value=0.17) Length = 797 Score = 28.3 bits (60), Expect = 3.8 Identities = 23/76 (30%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ LSA HV + + +T P R +A L TP+ +D++ IL G E K Sbjct: 720 NLALSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSMSDMKAILHHYGAELSERK 779 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 780 MKEYMKALRTKKFSKL 795 >SB_22647| Best HMM Match : Ribosomal_60s (HMM E-Value=0.43) Length = 462 Score = 28.3 bits (60), Expect = 3.8 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ D++ IL G E EK Sbjct: 26 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKEDMKAILHDYGAELSEEK 85 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 86 MKEYMEALKKKKFSKL 101 >SB_16596| Best HMM Match : Pox_A32 (HMM E-Value=0.017) Length = 305 Score = 28.3 bits (60), Expect = 3.8 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ D++ IL G E EK Sbjct: 110 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKEDMKAILHDYGAELSEEK 169 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 170 MKEYMEALKKKKFSKL 185 >SB_8388| Best HMM Match : ig (HMM E-Value=8.80001e-41) Length = 666 Score = 28.3 bits (60), Expect = 3.8 Identities = 18/45 (40%), Positives = 27/45 (60%) Frame = -1 Query: 244 NKLFNILAVELSDYFLKLLSVSFDTDGAEDLLNVSGSWRSLATQH 110 NK+ NIL+V+ SD +K SV D+ L++SGS S+ Q+ Sbjct: 81 NKV-NILSVDASDVDIKTYSVPIDSTLDRVTLSISGSDISIKIQN 124 >SB_25448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 538 Score = 28.3 bits (60), Expect = 3.8 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 486 TPSKADMKAILHDNGAELSEEKIKEYMKALKTKKFAKL 523 >SB_14410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 710 Score = 28.3 bits (60), Expect = 3.8 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 386 TPSKADMKAILHDNGAELSEEKIKEYMKALKTKKFAKL 423 >SB_54102| Best HMM Match : Pox_A32 (HMM E-Value=2.6) Length = 268 Score = 27.9 bits (59), Expect = 5.1 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ +L G E EK+++ + L K +L Sbjct: 136 TPSKADMKAVLHDYGAELSEEKMREYMKALKTKKFSKL 173 >SB_49008| Best HMM Match : AAA (HMM E-Value=0.46) Length = 593 Score = 27.9 bits (59), Expect = 5.1 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP AD++ +L G E EK+K+ L K +L Sbjct: 340 TPGKADMKAVLHDYGAELSEEKMKEYTKALKTKKFSKL 377 >SB_33380| Best HMM Match : Herpes_capsid (HMM E-Value=3) Length = 474 Score = 27.9 bits (59), Expect = 5.1 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = -2 Query: 258 SRPAAISCSTSLPLSSVIT-FLSFSASASIPTE-LRIFSTSAAAGVVLPPS 112 SRP STSL S+ T S +AS S+ T + STS+AA L P+ Sbjct: 128 SRPPPRPASTSLTTSAAFTSSTSSAASTSLTTSPVSTSSTSSAASTSLTPA 178 >SB_452| Best HMM Match : RVT_1 (HMM E-Value=9.9e-25) Length = 1486 Score = 27.9 bits (59), Expect = 5.1 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L + +L Sbjct: 1243 TPSKADMKAILHDYGAELSEEKMKEYMKALKTEKFSKL 1280 >SB_56634| Best HMM Match : Pox_A32 (HMM E-Value=0.011) Length = 684 Score = 27.9 bits (59), Expect = 5.1 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ A ++ IL G E EK+K+ + L K+ +L Sbjct: 146 TPSKAGMKAILHDYGAELSEEKMKEYMKALKTKEFSKL 183 >SB_54542| Best HMM Match : Ribosomal_60s (HMM E-Value=0.39) Length = 1037 Score = 27.9 bits (59), Expect = 5.1 Identities = 22/71 (30%), Positives = 34/71 (47%), Gaps = 5/71 (7%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 477 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 536 Query: 194 LKKVITELNGK 226 +++ + L K Sbjct: 537 MREYMKALKTK 547 >SB_46989| Best HMM Match : Pox_A32 (HMM E-Value=0.023) Length = 719 Score = 27.9 bits (59), Expect = 5.1 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 5/63 (7%) Frame = +2 Query: 29 NVILSALHVSCQLGLKK----CVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 629 NLAFSARHVGISVWVNTQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 688 Query: 194 LKK 202 +K+ Sbjct: 689 MKE 691 >SB_40742| Best HMM Match : Pox_A32 (HMM E-Value=0.042) Length = 579 Score = 27.9 bits (59), Expect = 5.1 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E +K+K+ + L K +L Sbjct: 531 TPSKADMKAILHDYGAELSEKKMKEYMKALKTKKFSKL 568 >SB_22139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1472 Score = 27.9 bits (59), Expect = 5.1 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K + L K +L Sbjct: 1060 TPSKADMKAILLDYGAELSEEKMKGYMKALKTKKFSKL 1097 >SB_4086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2235 Score = 27.9 bits (59), Expect = 5.1 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ +L G E EK+++ + L K +L Sbjct: 1579 TPSKADMKAVLHDYGAELSEEKMREYMKALKTKKFSKL 1616 >SB_47117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 869 Score = 27.5 bits (58), Expect = 6.7 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -2 Query: 252 PAAISCSTSLPLSSVITFLSFSASASIPTELRIF 151 P A ++SLPL +IT +S ++ + +F Sbjct: 777 PTAAEAASSLPLMKIITITGYSVGGAVLVTIAVF 810 >SB_26683| Best HMM Match : UPF0154 (HMM E-Value=7.3) Length = 419 Score = 27.5 bits (58), Expect = 6.7 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ A ++ IL G E EK+KK + L K +L Sbjct: 367 TPSKAYMKAILHDYGAELSEEKMKKYMKALKTKKFSKL 404 >SB_14136| Best HMM Match : Exonuc_X-T (HMM E-Value=6e-25) Length = 1597 Score = 27.5 bits (58), Expect = 6.7 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E K Sbjct: 1507 NLAFSARHVGSSVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEGK 1566 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 1567 MKEYMKALKTKKFSKL 1582 >SB_28106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1206 Score = 27.5 bits (58), Expect = 6.7 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ AD++ IL G E EK+K+ + L +L Sbjct: 433 TPSKADMKAILHDYGAELSEEKMKEYMKALKTNKFSKL 470 >SB_53159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1540 Score = 27.1 bits (57), Expect = 8.9 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 TP+ D++ IL G E EK+K+ + L K +L Sbjct: 925 TPSKTDMKAILHDYGAELSEEKMKEHMKALKTKKFSKL 962 >SB_38937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2085 Score = 27.1 bits (57), Expect = 8.9 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 5/63 (7%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G E EK Sbjct: 1131 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEK 1190 Query: 194 LKK 202 +K+ Sbjct: 1191 MKE 1193 >SB_36890| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1881 Score = 27.1 bits (57), Expect = 8.9 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 5/65 (7%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ AD++ IL G + EK Sbjct: 1331 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKADIKAILHDYGAQLSEEK 1390 Query: 194 LKKVI 208 +K ++ Sbjct: 1391 MKYLV 1395 >SB_18844| Best HMM Match : tRNA-synt_1b (HMM E-Value=0) Length = 252 Score = 27.1 bits (57), Expect = 8.9 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 176 EADAEKLKKVITELNGKDVEQLIAAGRE 259 + D+EK K+ T L+ K++E LIA +E Sbjct: 209 DEDSEKYIKIFTFLSQKEIETLIAEHKE 236 >SB_15432| Best HMM Match : Ribosomal_L10 (HMM E-Value=3.1e-37) Length = 261 Score = 27.1 bits (57), Expect = 8.9 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 Query: 347 EDXKXXXKXXSESDDDMGFG 406 E+ K + ESDDDMGFG Sbjct: 175 EEKKAEPEEEEESDDDMGFG 194 >SB_12591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 571 Score = 27.1 bits (57), Expect = 8.9 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 5/76 (6%) Frame = +2 Query: 29 NVILSALHVSCQLGL----KKCVTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEK 193 N+ SA HV + + +T P R +A L TP+ A ++ IL G E EK Sbjct: 481 NLAFSARHVGISVWVITQQLTSITKPFRENIAALVVFYTPSKAHMKAILHDYGSELSEEK 540 Query: 194 LKKVITELNGKDVEQL 241 +K+ + L K +L Sbjct: 541 MKEYMKALKTKKFSKL 556 >SB_51614| Best HMM Match : ROK (HMM E-Value=7) Length = 727 Score = 27.1 bits (57), Expect = 8.9 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +2 Query: 83 VTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 +T P R +A L TP+ AD++ IL G E EK+K+ + K +L Sbjct: 659 ITKPFRENIAALVVLYTPSKADMKAILHDYGAELSEEKMKEYMKAPKTKKFSKL 712 >SB_43987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 970 Score = 27.1 bits (57), Expect = 8.9 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = +2 Query: 134 AAADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAA-GREKLSSM 274 A DV++I ++ AE+ K +T LNG V Q+ +A R+ S+ Sbjct: 105 AGPDVQEIFETLPETGTAEEYGKAVTALNGYFVPQVNSAFARQAFKSL 152 >SB_16972| Best HMM Match : Ribosomal_60s (HMM E-Value=0.51) Length = 1275 Score = 27.1 bits (57), Expect = 8.9 Identities = 17/53 (32%), Positives = 24/53 (45%) Frame = +2 Query: 128 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGREKLSSMPVGG 286 T + AD++ IL G E EK+K+ + L K E L S+ GG Sbjct: 817 TLSKADMKTILHDYGAELSEEKMKEYMKALKTKKFSNHGMMSDEYLESLLKGG 869 >SB_3898| Best HMM Match : CITED (HMM E-Value=1.5) Length = 1166 Score = 27.1 bits (57), Expect = 8.9 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +2 Query: 83 VTWP-RYLLAVLGGKTTPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 241 +T P R +A L TP+ AD++ IL G E EK+K+ + K +L Sbjct: 1098 ITKPFRENIAALVVLYTPSKADMKAILHDYGAELSEEKMKEYMKAPKTKKFSKL 1151 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,669,006 Number of Sequences: 59808 Number of extensions: 169233 Number of successful extensions: 698 Number of sequences better than 10.0: 195 Number of HSP's better than 10.0 without gapping: 676 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 694 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1111677931 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -