BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_A17 (652 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 24 3.6 DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. 24 4.8 AY724808-1|AAW50317.1| 206|Anopheles gambiae G protein alpha su... 24 4.8 AY724807-1|AAW50316.1| 127|Anopheles gambiae G protein alpha su... 24 4.8 AY724806-1|AAW50315.1| 163|Anopheles gambiae G protein alpha su... 24 4.8 AY724805-1|AAW50314.1| 162|Anopheles gambiae G protein alpha su... 24 4.8 AY724804-1|AAW50313.1| 163|Anopheles gambiae G protein alpha su... 24 4.8 AY724803-1|AAW50312.1| 162|Anopheles gambiae G protein alpha su... 24 4.8 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 24.2 bits (50), Expect = 3.6 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = +2 Query: 191 FTRNSPI*RLKIMFFPCYCATCVGGSYRIVTSLC 292 +T PI LK F Y V G Y ++ LC Sbjct: 512 YTARHPIGSLKRFGFHTYLIDMVQGPYPVLNGLC 545 >DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. Length = 353 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -3 Query: 128 HTTNSIFLIDLSELESRLFVNKNKS 54 + T+ IFL+ LSE + LF ++N++ Sbjct: 216 NVTSIIFLVALSEYDQILFESENEN 240 >AY724808-1|AAW50317.1| 206|Anopheles gambiae G protein alpha subunit AgGq6 protein. Length = 206 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -3 Query: 128 HTTNSIFLIDLSELESRLFVNKNKS 54 + T+ IFL+ LSE + LF ++N++ Sbjct: 73 NVTSIIFLVALSEYDQILFESENEN 97 >AY724807-1|AAW50316.1| 127|Anopheles gambiae G protein alpha subunit AgGq5 protein. Length = 127 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -3 Query: 128 HTTNSIFLIDLSELESRLFVNKNKS 54 + T+ IFL+ LSE + LF ++N++ Sbjct: 30 NVTSIIFLVALSEYDQILFESENEN 54 >AY724806-1|AAW50315.1| 163|Anopheles gambiae G protein alpha subunit AgGq4 protein. Length = 163 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -3 Query: 128 HTTNSIFLIDLSELESRLFVNKNKS 54 + T+ IFL+ LSE + LF ++N++ Sbjct: 30 NVTSIIFLVALSEYDQILFESENEN 54 >AY724805-1|AAW50314.1| 162|Anopheles gambiae G protein alpha subunit AgGq3 protein. Length = 162 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -3 Query: 128 HTTNSIFLIDLSELESRLFVNKNKS 54 + T+ IFL+ LSE + LF ++N++ Sbjct: 29 NVTSIIFLVALSEYDQILFESENEN 53 >AY724804-1|AAW50313.1| 163|Anopheles gambiae G protein alpha subunit AgGq2 protein. Length = 163 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -3 Query: 128 HTTNSIFLIDLSELESRLFVNKNKS 54 + T+ IFL+ LSE + LF ++N++ Sbjct: 30 NVTSIIFLVALSEYDQILFESENEN 54 >AY724803-1|AAW50312.1| 162|Anopheles gambiae G protein alpha subunit AgGq1 protein. Length = 162 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -3 Query: 128 HTTNSIFLIDLSELESRLFVNKNKS 54 + T+ IFL+ LSE + LF ++N++ Sbjct: 29 NVTSIIFLVALSEYDQILFESENEN 53 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 570,341 Number of Sequences: 2352 Number of extensions: 10544 Number of successful extensions: 19 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -