BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_A16 (562 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 23 5.2 AJ439060-9|CAD27760.1| 348|Anopheles gambiae putative translati... 23 6.8 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 23.4 bits (48), Expect = 5.2 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -2 Query: 204 WSCXXWSLAMISTFPCWKT 148 W C WS+A T C +T Sbjct: 21 WDCTVWSMASNRTVRCPRT 39 >AJ439060-9|CAD27760.1| 348|Anopheles gambiae putative translation initiation factor protein. Length = 348 Score = 23.0 bits (47), Expect = 6.8 Identities = 11/40 (27%), Positives = 15/40 (37%) Frame = -3 Query: 464 KHHGTDFLGEKGFVFTLICYLDXRFASITDNLERPVLHVG 345 KHHG F F + D I + E + H+G Sbjct: 263 KHHGVPFYVAAPFTSIDVAIEDGSHIKIEERPEHELTHIG 302 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 538,341 Number of Sequences: 2352 Number of extensions: 9669 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52563375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -