BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_A15 (489 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase doma... 27 0.14 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 24 1.00 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 24 1.00 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 23 1.7 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 23 1.7 L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein pro... 23 2.3 AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodo... 22 4.0 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 7.0 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 7.0 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 21 9.3 >DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase domain protein protein. Length = 448 Score = 26.6 bits (56), Expect = 0.14 Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +3 Query: 291 KIPXWFLNRQKDIVDGKYSQLTSSNLDSKLRED-LERLKKI 410 KI WFL++ K+I+D Y L +++ +L D L R K+I Sbjct: 275 KIDKWFLHKMKNIID-YYLVLENTDHTKQLSHDVLLRAKQI 314 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.8 bits (49), Expect = 1.00 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 318 QKDIVDGKYSQLTSSNLDSKLREDLERLKKIRA 416 + D + QLTSS +S + D +LK IRA Sbjct: 1781 ESDESESDPDQLTSSRTESSNQLDAGKLKHIRA 1813 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.8 bits (49), Expect = 1.00 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 318 QKDIVDGKYSQLTSSNLDSKLREDLERLKKIRA 416 + D + QLTSS +S + D +LK IRA Sbjct: 1777 ESDESESDPDQLTSSRTESSNQLDAGKLKHIRA 1809 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 23.0 bits (47), Expect = 1.7 Identities = 11/48 (22%), Positives = 23/48 (47%) Frame = -3 Query: 298 GILYCXGFDMIVIIFSTSSSVHSPARLSRSMSAFLRTMLEYLRPTPLI 155 G + G M+V IF ++ S+ +P+ L A ++ + P++ Sbjct: 63 GFVSAMGNGMVVYIFLSTKSLRTPSNLFVINLAISNFLMMFCMSPPMV 110 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 23.0 bits (47), Expect = 1.7 Identities = 17/57 (29%), Positives = 26/57 (45%) Frame = +3 Query: 165 VGRRYSNIVLKKADIDLDKRAGECTEEEVEKIITIMSNPXQYKIPXWFLNRQKDIVD 335 +G+R S V K A T +E+EKI T+ +K L+R + +VD Sbjct: 3 LGQRISGAVAVLRGTSEVKEAQTSTSDEIEKITTVEEEKICHK-AITPLDRLQRVVD 58 >L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein protein. Length = 69 Score = 22.6 bits (46), Expect = 2.3 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -1 Query: 135 PFVCHRCSYS 106 PF C +CSYS Sbjct: 16 PFKCEKCSYS 25 >AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodopsin protein. Length = 152 Score = 21.8 bits (44), Expect = 4.0 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = -3 Query: 298 GILYCXGFDMIVIIFSTSSSVHSPARL 218 G + G M+V IF ++ S+ +P+ L Sbjct: 29 GFVSVMGNGMVVYIFLSTKSLRTPSNL 55 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.0 bits (42), Expect = 7.0 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -1 Query: 213 DQCRLF*EQCWS 178 D+C EQCWS Sbjct: 829 DECWRLMEQCWS 840 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.0 bits (42), Expect = 7.0 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -1 Query: 213 DQCRLF*EQCWS 178 D+C EQCWS Sbjct: 867 DECWRLMEQCWS 878 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 20.6 bits (41), Expect = 9.3 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +2 Query: 86 STYSSYHEYEHRW 124 +TY+ EY+H W Sbjct: 153 TTYTPVCEYDHTW 165 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,529 Number of Sequences: 438 Number of extensions: 2971 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13421061 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -