BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_A14 (445 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50472-1|AAA93475.1| 141|Anopheles gambiae protein ( Anopheles ... 101 2e-23 AY341159-1|AAR13723.1| 159|Anopheles gambiae CED6 protein. 24 2.8 AY341158-1|AAR13722.1| 159|Anopheles gambiae CED6 protein. 24 2.8 AY341157-1|AAR13721.1| 159|Anopheles gambiae CED6 protein. 24 2.8 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 23 6.4 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 23 6.4 AY341161-1|AAR13725.1| 159|Anopheles gambiae CED6 protein. 22 8.5 AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein... 22 8.5 AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 22 8.5 >U50472-1|AAA93475.1| 141|Anopheles gambiae protein ( Anopheles gambiae putativefatty acid binding protein mRNA, partial cds. ). Length = 141 Score = 101 bits (241), Expect = 2e-23 Identities = 47/92 (51%), Positives = 60/92 (65%) Frame = +2 Query: 95 GKKYKMTSSENFDEFMKTIGVGLITRKAANAVTPTVELRKDGDEYNLVTSSTFKTTEMKF 274 GKKYKM SE FD++M +GVG++ RK N+++PTVEL K+GDEY T S +T Sbjct: 35 GKKYKMEKSEGFDDYMLALGVGMVLRKLGNSISPTVELVKNGDEYTFNTLSPSRTRRSSS 94 Query: 275 KPGEEFEEDRADGAKVKSVCTFEGNTLKQVQK 370 EF+E+ DG VKSVCTF+GN L QK Sbjct: 95 SWAMEFDEETVDGRMVKSVCTFDGNKLIHEQK 126 >AY341159-1|AAR13723.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.8 bits (49), Expect = 2.8 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 173 KAANAVTPTVELRKDGDEYNLVTSST 250 K VTPT + GD+ N +ST Sbjct: 89 KTGTGVTPTSSIASSGDDTNSSNNST 114 >AY341158-1|AAR13722.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.8 bits (49), Expect = 2.8 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 173 KAANAVTPTVELRKDGDEYNLVTSST 250 K VTPT + GD+ N +ST Sbjct: 89 KTGTGVTPTSSIASSGDDTNSSNNST 114 >AY341157-1|AAR13721.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.8 bits (49), Expect = 2.8 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 173 KAANAVTPTVELRKDGDEYNLVTSST 250 K VTPT + GD+ N +ST Sbjct: 89 KTGTGVTPTSSIASSGDDTNSSNNST 114 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 22.6 bits (46), Expect = 6.4 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -1 Query: 193 GDSVGGFAGDQTHA 152 G G FAGD+TH+ Sbjct: 988 GSDDGSFAGDKTHS 1001 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 22.6 bits (46), Expect = 6.4 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -1 Query: 193 GDSVGGFAGDQTHA 152 G G FAGD+TH+ Sbjct: 986 GSDDGSFAGDKTHS 999 >AY341161-1|AAR13725.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 22.2 bits (45), Expect = 8.5 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = +2 Query: 173 KAANAVTPTVELRKDGDEYNLVTSST 250 K TPT + GD+ N +ST Sbjct: 89 KTGTGATPTSSIASSGDDTNSSNNST 114 >AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein coupled receptor protein. Length = 695 Score = 22.2 bits (45), Expect = 8.5 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -2 Query: 246 EEVTKLYSSPSLRSS 202 E V K+YSS SLR S Sbjct: 128 ENVIKVYSSKSLRKS 142 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 22.2 bits (45), Expect = 8.5 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +3 Query: 351 PSSKSRRPPTVLKSLTSGNSALEEMK 428 PS+ SR+PPT L +S ++ + Sbjct: 173 PSASSRQPPTPLPRRSSAQPQQQQQQ 198 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 413,013 Number of Sequences: 2352 Number of extensions: 7341 Number of successful extensions: 18 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 37418568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -