BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_A10 (585 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 3.9 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 5.1 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 5.1 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 6.7 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 6.7 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 21 8.9 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 22.2 bits (45), Expect = 3.9 Identities = 10/36 (27%), Positives = 23/36 (63%) Frame = -3 Query: 184 LIRTRSRRGTNRFTALAISIFN*QNSKAKNMSTMNA 77 +IR+RSRR + RF++ + + +S++ + S + + Sbjct: 16 IIRSRSRRYSKRFSSSIVDRRSPSSSRSPSPSLLTS 51 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 5.1 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 Query: 514 IWSCIFCEVLIL 549 IWSC+F +LIL Sbjct: 375 IWSCLFFFMLIL 386 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 5.1 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 Query: 514 IWSCIFCEVLIL 549 IWSC+F +LIL Sbjct: 428 IWSCLFFFMLIL 439 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.4 bits (43), Expect = 6.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +2 Query: 104 F*ILLIKNRNGQCSKTIGSSSGPCP 178 F LL K RNG T+ +++ CP Sbjct: 289 FDCLLKKERNGPTQTTLNATTLFCP 313 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.4 bits (43), Expect = 6.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +2 Query: 104 F*ILLIKNRNGQCSKTIGSSSGPCP 178 F LL K RNG T+ +++ CP Sbjct: 379 FDCLLKKERNGPTQTTLNATTLFCP 403 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 21.0 bits (42), Expect = 8.9 Identities = 8/27 (29%), Positives = 13/27 (48%) Frame = +2 Query: 266 SSGRSWSPKRKWRLHPRFKLVWVIKFF 346 S G + +W L LVW++ +F Sbjct: 163 SEGVEYVGNIRWELAGTLLLVWILCYF 189 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,994 Number of Sequences: 438 Number of extensions: 2842 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16993167 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -