BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_A08 (613 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U00036-4|AAK29850.1| 217|Caenorhabditis elegans Ribosomal prote... 90 1e-18 Z83102-9|CAI79156.1| 82|Caenorhabditis elegans Hypothetical pr... 31 0.65 >U00036-4|AAK29850.1| 217|Caenorhabditis elegans Ribosomal protein, large subunitprotein 6 protein. Length = 217 Score = 89.8 bits (213), Expect = 1e-18 Identities = 44/79 (55%), Positives = 55/79 (69%), Gaps = 1/79 (1%) Frame = +3 Query: 378 IRPNLKIGTVCILLAGRHAGXRVVLVGILP-SGLLLVTGPFAFNSCPLRRIPQRYVIGTS 554 +R L GTV I+LAGRH G RVV + LP SGLLLVTGP N PLRRI Q +VI TS Sbjct: 67 LRKTLTPGTVLIVLAGRHKGKRVVFLKQLPQSGLLLVTGPHKINGFPLRRIGQAFVIATS 126 Query: 555 TRISLGNFKLPKHFNDDYF 611 ++++ K+P+H ND+YF Sbjct: 127 LKVNVSGVKIPEHINDEYF 145 Score = 29.9 bits (64), Expect = 1.5 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +3 Query: 114 RNYDLGNGVMRFSKSKMFHKKAKYK 188 RN+DL GV+RFS S++ KK + K Sbjct: 12 RNFDLSPGVLRFSASRLRLKKGEKK 36 >Z83102-9|CAI79156.1| 82|Caenorhabditis elegans Hypothetical protein C54C8.12 protein. Length = 82 Score = 31.1 bits (67), Expect = 0.65 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +3 Query: 309 FYPTQEKIRASSGGRPFSKHVRRIRPNLKIGTVCILLAGRHAGXR 443 FYPT+ +A S G P + PN ++ V A RHAG R Sbjct: 26 FYPTEISTKARSHGHPVNTLGESEDPNFQVDNVPGERARRHAGPR 70 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,111,309 Number of Sequences: 27780 Number of extensions: 245083 Number of successful extensions: 538 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 511 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 537 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1321669750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -