BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_A06 (619 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54575| Best HMM Match : S10_plectin (HMM E-Value=0) 188 2e-48 SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) 30 1.3 SB_37766| Best HMM Match : IncA (HMM E-Value=0.4) 29 2.3 SB_46720| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_40971| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_3936| Best HMM Match : Collagen (HMM E-Value=7.5e-24) 28 7.0 SB_58477| Best HMM Match : Ion_trans (HMM E-Value=1.2e-25) 27 9.2 SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_54575| Best HMM Match : S10_plectin (HMM E-Value=0) Length = 166 Score = 188 bits (459), Expect = 2e-48 Identities = 97/160 (60%), Positives = 115/160 (71%), Gaps = 4/160 (2%) Frame = +3 Query: 42 MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELXKIPNLQVIKAMQSLKSRGYVKEQF 221 ML+PK+NRV IYEYLFKEGV VAKKD+++PKHT++ +PNL VIKA+QSLKSRGYV+E+F Sbjct: 1 MLIPKKNRVIIYEYLFKEGVCVAKKDFNSPKHTQIENVPNLHVIKALQSLKSRGYVEEKF 60 Query: 222 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSV-RTETVRRGPVGR--PDAPARSAE 392 W+H+YW LTNEGI YLR FLHLP EIVPATL+R V R ET R P G P P + Sbjct: 61 CWKHYYWNLTNEGITYLRDFLHLPTEIVPATLRRQVTRAETARPRPKGMDGPRGPGEGGD 120 Query: 393 -DRSAYRRTPAAPGVAPHDKKADVGPGSADLEFXGGYGRG 509 DR +YRR P PGV + K G G EF G+GRG Sbjct: 121 RDRESYRRGP-PPGV---EGKGGAGSGFKP-EFRQGFGRG 155 >SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 2075 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/22 (59%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = +3 Query: 411 RTPAAPGVAPHDK-KADVGPGS 473 +TPA PG+AP D K VGPG+ Sbjct: 365 KTPALPGIAPSDALKGTVGPGN 386 >SB_37766| Best HMM Match : IncA (HMM E-Value=0.4) Length = 585 Score = 29.5 bits (63), Expect = 2.3 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +3 Query: 420 AAPGVAPHDKKADVGP 467 A PG+APHDKK+ GP Sbjct: 545 ARPGLAPHDKKSGKGP 560 >SB_46720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1705 Score = 27.9 bits (59), Expect = 7.0 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +3 Query: 348 RGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGP 467 +GP+G P P + R P PG P K+ + GP Sbjct: 199 QGPIGPPGRPGPKGPKDTCPRCPPGPPG--PKGKRGETGP 236 >SB_40971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 828 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/53 (30%), Positives = 22/53 (41%), Gaps = 4/53 (7%) Frame = +3 Query: 285 HLPPEIVPATLKRSVRTETVRRGPVGRPDAP----ARSAEDRSAYRRTPAAPG 431 HL P ++ + S+ RGP GRP P R + R P +PG Sbjct: 110 HLSPAVIRLCMGGSLTCPPGPRGPPGRPGHPGQKGTRGRRGQRGRRGNPGSPG 162 >SB_3936| Best HMM Match : Collagen (HMM E-Value=7.5e-24) Length = 270 Score = 27.9 bits (59), Expect = 7.0 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +3 Query: 348 RGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGP 467 +GP+G P P + R P PG P K+ + GP Sbjct: 199 QGPIGPPGRPGPKGPKDTCPRCPPGPPG--PKGKRGETGP 236 >SB_58477| Best HMM Match : Ion_trans (HMM E-Value=1.2e-25) Length = 578 Score = 27.5 bits (58), Expect = 9.2 Identities = 19/73 (26%), Positives = 37/73 (50%) Frame = +3 Query: 114 KDYHAPKHTELXKIPNLQVIKAMQSLKSRGYVKEQFAWRHFYWYLTNEGIEYLRIFLHLP 293 +DY A T I + ++ + + SRG+VK+ +A+ W + + +L +L L Sbjct: 118 EDYDASGGTVY--ITAIYTLEMICKIISRGFVKDSYAYLRDTWNWLDSLVVFLS-YLSLA 174 Query: 294 PEIVPATLKRSVR 332 P+I + R++R Sbjct: 175 PDIASLSGIRTLR 187 >SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6406 Score = 27.5 bits (58), Expect = 9.2 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = +3 Query: 360 GRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGS 473 G P+ + S+E R RT AP P K PG+ Sbjct: 6325 GEPEGTSPSSESRIPVGRTTKAPTTKPASKTTTTRPGT 6362 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,368,537 Number of Sequences: 59808 Number of extensions: 327541 Number of successful extensions: 1094 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1027 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1094 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1524174750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -