BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_P21 (539 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) 186 1e-47 SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) 163 1e-40 SB_8490| Best HMM Match : HSP70 (HMM E-Value=0) 142 1e-34 SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) 106 1e-23 SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0) 38 0.005 SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) 37 0.012 SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.016 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) 35 0.049 SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.065 SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.085 SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.085 SB_35674| Best HMM Match : SH2 (HMM E-Value=0) 34 0.085 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 33 0.11 SB_39966| Best HMM Match : CRA_rpt (HMM E-Value=8.6) 33 0.15 SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_25234| Best HMM Match : SMC_hinge (HMM E-Value=3.7e-28) 32 0.26 SB_15392| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.26 SB_6714| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.26 SB_43252| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.34 SB_3733| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.34 SB_3809| Best HMM Match : DUF1014 (HMM E-Value=8.7e-09) 31 0.46 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.46 SB_40384| Best HMM Match : Filament (HMM E-Value=0.76) 31 0.60 SB_17273| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.60 SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) 31 0.60 SB_57319| Best HMM Match : Pox_A_type_inc (HMM E-Value=6.3e-06) 31 0.80 SB_54719| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.045) 31 0.80 SB_15994| Best HMM Match : Pox_A_type_inc (HMM E-Value=2e-06) 31 0.80 SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) 30 1.1 SB_46225| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00052) 30 1.1 SB_12462| Best HMM Match : Kinesin (HMM E-Value=0) 30 1.1 SB_42014| Best HMM Match : Myosin_tail_1 (HMM E-Value=0.083) 30 1.4 SB_26137| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.27) 30 1.4 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 30 1.4 SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) 30 1.4 SB_21264| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_58958| Best HMM Match : Baculo_PEP_C (HMM E-Value=0.35) 29 1.8 SB_54255| Best HMM Match : DUF329 (HMM E-Value=7.8) 29 1.8 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 29 1.8 SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_32331| Best HMM Match : DivIVA (HMM E-Value=0.86) 29 2.4 SB_29377| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_59386| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 29 2.4 SB_45987| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) 29 3.2 SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_6748| Best HMM Match : Pkinase (HMM E-Value=1.7e-05) 29 3.2 SB_35866| Best HMM Match : TPR_MLP1_2 (HMM E-Value=0.34) 29 3.2 SB_8304| Best HMM Match : PLAT (HMM E-Value=0) 29 3.2 SB_54892| Best HMM Match : DHH (HMM E-Value=0.057) 28 4.2 SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_49603| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_44787| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_33744| Best HMM Match : SMC_N (HMM E-Value=0) 28 4.2 SB_23940| Best HMM Match : MuDR (HMM E-Value=0.24) 28 4.2 SB_3878| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_52390| Best HMM Match : Cauli_DNA-bind (HMM E-Value=6.4) 28 4.2 SB_48270| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_24447| Best HMM Match : TolA (HMM E-Value=1.3) 28 4.2 SB_23774| Best HMM Match : Kinesin (HMM E-Value=0) 28 4.2 SB_7914| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_47024| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_40334| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 28 5.6 SB_32124| Best HMM Match : K-box (HMM E-Value=4.1) 28 5.6 SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 28 5.6 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 28 5.6 SB_3000| Best HMM Match : Extensin_2 (HMM E-Value=0.058) 28 5.6 SB_1305| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.8e-11) 28 5.6 SB_40368| Best HMM Match : SASP_gamma (HMM E-Value=2.3) 28 5.6 SB_31962| Best HMM Match : DUF1168 (HMM E-Value=1.5) 28 5.6 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 28 5.6 SB_11774| Best HMM Match : M (HMM E-Value=8.5e-09) 28 5.6 SB_11244| Best HMM Match : M (HMM E-Value=2.5e-08) 28 5.6 SB_49860| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.4 SB_33413| Best HMM Match : DUF81 (HMM E-Value=0.31) 27 7.4 SB_23579| Best HMM Match : PspA_IM30 (HMM E-Value=1.5) 27 7.4 SB_17208| Best HMM Match : RVT_1 (HMM E-Value=6.4e-19) 27 7.4 SB_51904| Best HMM Match : CH (HMM E-Value=0.0058) 27 7.4 SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.4 SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) 27 7.4 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.4 SB_18255| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.4 SB_3240| Best HMM Match : Sec8_exocyst (HMM E-Value=0.48) 27 7.4 SB_58677| Best HMM Match : Pkinase (HMM E-Value=2.8e-33) 27 9.8 SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) 27 9.8 SB_49873| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_16769| Best HMM Match : DUF1690 (HMM E-Value=0.17) 27 9.8 SB_12881| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_56568| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_49663| Best HMM Match : TolA (HMM E-Value=0.059) 27 9.8 SB_35403| Best HMM Match : Lectin_C (HMM E-Value=1e-05) 27 9.8 SB_32504| Best HMM Match : TolA (HMM E-Value=0.52) 27 9.8 SB_31142| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_23985| Best HMM Match : CRAM_rpt (HMM E-Value=3.4) 27 9.8 SB_6619| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 >SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1097 Score = 186 bits (452), Expect = 1e-47 Identities = 81/125 (64%), Positives = 105/125 (84%) Frame = +2 Query: 2 ITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKE 181 ITITNDKGRLSKE+IERMVNEA KY+ ED+KQ++ IQ KN+LESY +SMKST+ED+K+K+ Sbjct: 503 ITITNDKGRLSKEDIERMVNEASKYKEEDEKQRDRIQTKNSLESYAYSMKSTVEDDKVKD 562 Query: 182 KISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGICNPIITKMYQXCRRSPRR 361 KIS+ DK+ ILDKC + +KWLD+NQ A+K+E+E+ QKELE +CNPIITK+YQ +P Sbjct: 563 KISEEDKKAILDKCTEVLKWLDTNQTAEKDEFEYHQKELEKVCNPIITKLYQQAGGAPPG 622 Query: 362 YAGLP 376 G+P Sbjct: 623 AGGMP 627 >SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 746 Score = 163 bits (395), Expect = 1e-40 Identities = 71/112 (63%), Positives = 94/112 (83%) Frame = +2 Query: 2 ITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKE 181 ITITNDKGRLSKE+IERMV EAEK++ D+ +E IQ+KN+LESY FSMKSTMEDEK+K+ Sbjct: 595 ITITNDKGRLSKEDIERMVKEAEKFKAADEAVRERIQSKNSLESYAFSMKSTMEDEKVKD 654 Query: 182 KISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGICNPIITKMYQ 337 K+S+ +++ ++ +C T+ WL+ NQ A+KEE + QKELEG+CNPIITK+YQ Sbjct: 655 KLSEDEREKVISRCKATLDWLEHNQSAEKEEIDAHQKELEGVCNPIITKLYQ 706 >SB_8490| Best HMM Match : HSP70 (HMM E-Value=0) Length = 640 Score = 142 bits (345), Expect = 1e-34 Identities = 60/111 (54%), Positives = 88/111 (79%) Frame = +2 Query: 2 ITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKE 181 ITITNDKGRLSKEEI+RM+N+AEKY++ED+ Q+E I A+N LESY F +KS + + L+ Sbjct: 502 ITITNDKGRLSKEEIDRMINDAEKYKSEDEAQREKIAARNRLESYAFGVKSAISEPSLEG 561 Query: 182 KISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGICNPIITKMY 334 K+S SDK T+ +K + + WL+ N LA+KEE+E ++KEL+ +C+PI+ K++ Sbjct: 562 KLSQSDKDTVKNKVEEVLNWLEKNSLAEKEEFEEQEKELQRVCSPIMAKVH 612 >SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1327 Score = 106 bits (255), Expect = 1e-23 Identities = 49/106 (46%), Positives = 77/106 (72%), Gaps = 1/106 (0%) Frame = +2 Query: 2 ITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMED-EKLK 178 ITITND+ RL+ E+IERMVN+AEK+ +ED K KE ++A+N LESY +S+K+ + D EKL Sbjct: 1196 ITITNDQNRLTPEDIERMVNDAEKFADEDKKTKEKVEARNELESYAYSLKNQVGDKEKLG 1255 Query: 179 EKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGICNP 316 K+S+ DK+TI + I W+D NQ A E+++ ++++ + + +P Sbjct: 1256 GKLSEDDKKTITEAVEKAISWMDKNQDASVEDFKKEKRKWKMLYSP 1301 >SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1019 Score = 40.7 bits (91), Expect = 7e-04 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 1/65 (1%) Frame = +2 Query: 62 EAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKIS-DSDKQTILDKCNDTIK 238 EA K R DD + +AKNALES+ F ++ M E L EK+S +++++TI + Sbjct: 704 EAPKAR--DDAKAANERAKNALESHIFGVRDEMNSE-LGEKLSTEAERETISEALTAASD 760 Query: 239 WLDSN 253 WLD + Sbjct: 761 WLDED 765 >SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 823 Score = 37.9 bits (84), Expect = 0.005 Identities = 25/98 (25%), Positives = 51/98 (52%), Gaps = 3/98 (3%) Frame = +2 Query: 47 ERMVNEAEKYRNEDD-KQKETIQAKNALESYCFSMKSTMED-EKLKEKISDSDKQTILDK 220 ER A +Y D + + +A+ L++ S K T+ D +K + + D+ + Sbjct: 712 ERAREAATRYNKVDCIEYLDKAEAQFELKALITSTKETIADPDKHMGRFTKDDRVSGNRY 771 Query: 221 CNDTIKWLDSN-QLADKEEYEHKQKELEGICNPIITKM 331 C++ +WL++N A EE ++++L G+ PI++K+ Sbjct: 772 CDEKSEWLENNADTASLEEIVKQKEDLAGVLQPILSKL 809 >SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) Length = 256 Score = 36.7 bits (81), Expect = 0.012 Identities = 23/91 (25%), Positives = 45/91 (49%) Frame = +2 Query: 35 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 214 K E+E+ E EK R E +KQ+ + K LES ++ + + EK + ++ ++ Sbjct: 105 KNEVEKERQEEEKRRMEIEKQRMESEKKRILESKQKRIEESKDTIHDNEKFLEEQRKRLV 164 Query: 215 DKCNDTIKWLDSNQLADKEEYEHKQKELEGI 307 +K + + + L D+ + E +Q EG+ Sbjct: 165 EKVKN--EGEEERMLHDQRQKEEEQWRKEGV 193 >SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 766 Score = 36.3 bits (80), Expect = 0.016 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 2/70 (2%) Frame = +2 Query: 8 ITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESY--CFSMKSTMEDEKLKE 181 + G LSK+ IE M+ EAEKY E DKQK+ + K + + K E +++ Sbjct: 308 VIQSSGGLSKDAIENMIKEAEKYA-EADKQKKVEKLKEEIAKVREVLANKDNETGETIRQ 366 Query: 182 KISDSDKQTI 211 S+ ++++ Sbjct: 367 AYSELQQKSL 376 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 35.5 bits (78), Expect = 0.028 Identities = 24/91 (26%), Positives = 52/91 (57%), Gaps = 1/91 (1%) Frame = +2 Query: 32 SKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSM-KSTMEDEKLKEKISDSDKQT 208 SKE+++ ++EA +D + ++A + ++ S+ + E E +KE + +++++ Sbjct: 1035 SKEKLQHRLDEA--LCKQDQYKNSLVEAVDEAKTLKESLYRMVNEHETMKESLLNANREI 1092 Query: 209 ILDKCNDTIKWLDSNQLADKEEYEHKQKELE 301 KC +T K LD+++ D+E+ E Q+E E Sbjct: 1093 GRLKCENTAKNLDADRKEDQED-EEVQREGE 1122 Score = 33.9 bits (74), Expect = 0.085 Identities = 27/97 (27%), Positives = 50/97 (51%), Gaps = 4/97 (4%) Frame = +2 Query: 20 KGRLSKEEIERMVNEAEKYRNE--DDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISD 193 K +L KE+++ +VN + +E D+K K + K L+ + + K + +D Sbjct: 1630 KDKLLKEKVD-LVNSLHEKMSEMNDEKDKLDDENKQLLDEKSREVTDLKGEVKKAQDDAD 1688 Query: 194 SDKQTI--LDKCNDTIKWLDSNQLADKEEYEHKQKEL 298 S K+ + + + NDT+K + + LA +E+ EH EL Sbjct: 1689 SVKRLVDAIIEENDTLKQSEHDLLAIQEDLEHTIDEL 1725 Score = 31.9 bits (69), Expect = 0.34 Identities = 24/92 (26%), Positives = 40/92 (43%) Frame = +2 Query: 20 KGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSD 199 K EIE M EK R +++ ++ + + L + S +E+ +E +SDSD Sbjct: 1939 KNEEKNNEIEEM---REKMRKANEEIEKILSKNSKLSDILNELNSGIENILNEETLSDSD 1995 Query: 200 KQTILDKCNDTIKWLDSNQLADKEEYEHKQKE 295 L K + + L+ KEE E +E Sbjct: 1996 PNVKLQKLREKFENLEKQVNNVKEEAEKNVQE 2027 Score = 30.3 bits (65), Expect = 1.1 Identities = 25/87 (28%), Positives = 44/87 (50%) Frame = +2 Query: 35 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 214 KEE E +V + + RN+ K+ E ++++ L K M+DE K + ++ +L Sbjct: 2543 KEEAEGLVEKLKVQRNQMIKEIEELKSEKGL----LEQKQQMQDEAQKLR----NEIEVL 2594 Query: 215 DKCNDTIKWLDSNQLADKEEYEHKQKE 295 K + I D+NQ ++KE K K+ Sbjct: 2595 KKLH-AIALEDANQKSEKELRREKMKK 2620 >SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) Length = 1866 Score = 34.7 bits (76), Expect = 0.049 Identities = 23/94 (24%), Positives = 50/94 (53%), Gaps = 1/94 (1%) Frame = +2 Query: 17 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 196 +K + K++ ER E ++ + + +K+K+ + K +E + + E+L+EK + Sbjct: 908 EKEKREKDKREREEKERKRRQQQLEKEKKEKEKKLLIEKE--KREKEKQKERLREK-EEK 964 Query: 197 DKQTILDKC-NDTIKWLDSNQLADKEEYEHKQKE 295 +KQ ++ + + L ++L +KEE + K KE Sbjct: 965 EKQKEAERAKKEKERLLQEDKLHEKEEKDRKDKE 998 Score = 31.9 bits (69), Expect = 0.34 Identities = 26/94 (27%), Positives = 49/94 (52%) Frame = +2 Query: 20 KGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSD 199 K RL ++E + EAE+ + K+KE + ++ L + E K++++ + D Sbjct: 955 KERLREKEEKEKQKEAERAK----KEKERLLQEDKLHEKEEKDRKDKEKRKVEKEKREKD 1010 Query: 200 KQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 301 KQ +K D++K + + +DKE + K+KE E Sbjct: 1011 KQVEKEK-KDSLKRVKKRKDSDKER-KVKEKEEE 1042 Score = 28.7 bits (61), Expect = 3.2 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +3 Query: 6 PLPTTKVVSPRKRSSVWLMRQRSTETRMTSKRR 104 PLP T V R R WL + E+ TSK+R Sbjct: 297 PLPET-VAEERSRKGSWLRSLKKNESEKTSKKR 328 >SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 34.3 bits (75), Expect = 0.065 Identities = 26/107 (24%), Positives = 50/107 (46%), Gaps = 3/107 (2%) Frame = +2 Query: 8 ITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKI 187 + +K RL EE+ER+ E +K E+ K++ET++ K L+ + + KE+ Sbjct: 277 LEEEKKRL--EELERLKEEKDKMLEEELKKRETLEEKQKLQDKILEEERKRLENLEKER- 333 Query: 188 SDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE---GICNPI 319 Q + + +D + + EE + K +E++ G+ PI Sbjct: 334 --QAAQQAMQEAHDKLAAAEEAAKKASEEAKKKVREIKTCSGLARPI 378 >SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1967 Score = 33.9 bits (74), Expect = 0.085 Identities = 31/91 (34%), Positives = 47/91 (51%), Gaps = 1/91 (1%) Frame = +2 Query: 29 LSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQT 208 L ++ +VNE +K + + D QK+ I+ + ES + ME EKLKE DK + Sbjct: 1182 LKAARLKELVNELDKMKKDLDAQKQAIEESRSEES---GIIGEME-EKLKE---SKDKIS 1234 Query: 209 ILD-KCNDTIKWLDSNQLADKEEYEHKQKEL 298 L+ ND K L+ L+ KE E K +E+ Sbjct: 1235 KLEGTLNDKAKALEKAHLSLKEA-ETKLEEM 1264 >SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1789 Score = 33.9 bits (74), Expect = 0.085 Identities = 24/99 (24%), Positives = 47/99 (47%), Gaps = 4/99 (4%) Frame = +2 Query: 17 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQA-KNALES---YCFSMKSTMEDEKLKEK 184 DKG K++ E ++ E +++ + +KE Q+ K ES C S K E EK E+ Sbjct: 1526 DKGESEKDKGESEKDKGESEKDKGESEKEKCQSEKEKCESEKEKCESEKEKCESEKKVEE 1585 Query: 185 ISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 301 D + + +++ D +K E + +++++E Sbjct: 1586 SKDENPEEKIEEKKDDTASEKKESSEEKMEVDGEEQKVE 1624 >SB_35674| Best HMM Match : SH2 (HMM E-Value=0) Length = 871 Score = 33.9 bits (74), Expect = 0.085 Identities = 24/99 (24%), Positives = 47/99 (47%), Gaps = 4/99 (4%) Frame = +2 Query: 17 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQA-KNALES---YCFSMKSTMEDEKLKEK 184 DKG K++ E ++ E +++ + +KE Q+ K ES C S K E EK E+ Sbjct: 105 DKGESEKDKGESEKDKGESEKDKGESEKEKCQSEKEKCESEKEKCESEKEKCESEKKVEE 164 Query: 185 ISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 301 D + + +++ D +K E + +++++E Sbjct: 165 SKDENPEEKIEEKKDDTASEKKESSEEKMEVDGEEQKVE 203 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 33.5 bits (73), Expect = 0.11 Identities = 30/104 (28%), Positives = 56/104 (53%), Gaps = 3/104 (2%) Frame = +2 Query: 5 TITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEK 184 T+ ND ++K+E+ER+ +K D+K+KE ++ K L+ TME ++L+ Sbjct: 3498 TVDND---ITKDELERL----KKIVENDEKEKENLKRK--LQG--SDSDGTMERKRLQRD 3546 Query: 185 ISDSDKQTILDKCNDTIKWL-DSNQLADKEEYE--HKQKELEGI 307 +SD+ + + + +K L D +LA K+ E K +E+E + Sbjct: 3547 MSDARAE--ISRLEKEVKRLKDDQELARKQRQEVIEKGREIEDL 3588 >SB_39966| Best HMM Match : CRA_rpt (HMM E-Value=8.6) Length = 159 Score = 33.1 bits (72), Expect = 0.15 Identities = 21/93 (22%), Positives = 46/93 (49%) Frame = +2 Query: 17 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 196 +K +K+E E E ++ + + +K++E + + + ++ E E KEK + Sbjct: 20 EKEAETKKEAETEKEEEKETKKKTEKEEEKWKQEETEKEAETEKEAETEKEAEKEKKKKT 79 Query: 197 DKQTILDKCNDTIKWLDSNQLADKEEYEHKQKE 295 +K+ K +T K ++ + A+ E+ E +KE Sbjct: 80 EKEEEKGKQEETGKEAETEKQAETEKQEETEKE 112 Score = 29.1 bits (62), Expect = 2.4 Identities = 22/80 (27%), Positives = 38/80 (47%) Frame = +2 Query: 62 EAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKW 241 E EK E +K+ ET + + + E +K EK + KQ +K +T K Sbjct: 6 ETEK-EGETEKEGETEKEAETKKEAETEKEEEKETKKKTEKEEEKWKQEETEKEAETEKE 64 Query: 242 LDSNQLADKEEYEHKQKELE 301 ++ + A+KE+ + +KE E Sbjct: 65 AETEKEAEKEKKKKTEKEEE 84 >SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 33.1 bits (72), Expect = 0.15 Identities = 29/99 (29%), Positives = 53/99 (53%), Gaps = 7/99 (7%) Frame = +2 Query: 32 SKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTI 211 S E+I +E + +N DK + + ++ E S K ++ +K ++ D +K+ Sbjct: 142 SSEKISEDEHEISQLKN--DKARCMQELRDEREK---SNKLVVDLQKTRKAQDDCEKE-- 194 Query: 212 LDKCNDTIKWLDSN------QLADK-EEYEHKQKELEGI 307 +++C TIK LDSN Q+AD+ EE + ++ELE + Sbjct: 195 VNRCEATIKTLDSNLKDLRQQVADRDEELNNNRQELESV 233 >SB_25234| Best HMM Match : SMC_hinge (HMM E-Value=3.7e-28) Length = 552 Score = 32.3 bits (70), Expect = 0.26 Identities = 18/57 (31%), Positives = 29/57 (50%) Frame = +2 Query: 68 EKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIK 238 E+ D QKE QA +E Y S++ E KE + S+K+ + ++C + IK Sbjct: 13 EESTRAGDLQKEVTQASENIEKYSQSIRDLGE----KENVLTSEKKQLEEECQENIK 65 >SB_15392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 32.3 bits (70), Expect = 0.26 Identities = 18/89 (20%), Positives = 46/89 (51%) Frame = +2 Query: 35 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 214 K+E++ + E+ + ++QK+ +Q + E K +++E+ K+++ + KQ + Sbjct: 88 KQEVQEEQKQEEQEEQKQEEQKQEVQEEQKQEEQ-EEQKQEVQEEQ-KQEVQEEQKQEVQ 145 Query: 215 DKCNDTIKWLDSNQLADKEEYEHKQKELE 301 ++ ++ + +E+ E KQ+E E Sbjct: 146 EEQKQEVQ----EEQKQEEQEEQKQEEQE 170 Score = 27.9 bits (59), Expect = 5.6 Identities = 16/87 (18%), Positives = 40/87 (45%) Frame = +2 Query: 35 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 214 K+E ++ + E+ + E ++QK+ +Q + E + E++K + + ++ Sbjct: 104 KQEEQKQEVQEEQKQEEQEEQKQEVQEEQKQEVQEEQKQEVQEEQKQEVQEEQKQEEQEE 163 Query: 215 DKCNDTIKWLDSNQLADKEEYEHKQKE 295 K + + Q K+E + +QK+ Sbjct: 164 QKQEEQEEQKQEVQEEQKQEVQEEQKQ 190 Score = 27.5 bits (58), Expect = 7.4 Identities = 14/89 (15%), Positives = 46/89 (51%) Frame = +2 Query: 35 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 214 K+E++ + E+ + ++QK+ +Q + E K +++E+ K+++ KQ Sbjct: 27 KQEVQEEQKQEEQKQEVQEEQKQEVQEEQKQEVQ-EEQKQKVQEEQ-KQEVQKEQKQEEQ 84 Query: 215 DKCNDTIKWLDSNQLADKEEYEHKQKELE 301 ++ ++ + ++++ E +++E++ Sbjct: 85 EEQKQEVQEEQKQEEQEEQKQEEQKQEVQ 113 >SB_6714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 32.3 bits (70), Expect = 0.26 Identities = 23/95 (24%), Positives = 47/95 (49%) Frame = +2 Query: 17 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 196 DK ++ KE+ E M + + N++DK++ + K ++ M ++E KE + Sbjct: 25 DKEKMDKEDKEEM--DKQDKENKEDKEEMDKEDKEEMDQE--EMDKEDKEEMDKEDKEEM 80 Query: 197 DKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 301 D++ +DK + +D DKEE + ++ + E Sbjct: 81 DQEE-MDKEEMDQEEMDKEDKEDKEEMDQEEMDKE 114 Score = 31.5 bits (68), Expect = 0.46 Identities = 23/92 (25%), Positives = 41/92 (44%) Frame = +2 Query: 20 KGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSD 199 KG + KE+ E M E +K + + KE K E + E++ +++ D Sbjct: 134 KGEMDKEDKEEMDQEMDKEEMDQEMDKE--MDKEDKEEMDQEEMDKQDKEEMDQEMDKQD 191 Query: 200 KQTILDKCNDTIKWLDSNQLADKEEYEHKQKE 295 K+ +D+ + + D DKEE + + KE Sbjct: 192 KEE-MDQ--EEMDKQDKENKEDKEEMDKQDKE 220 >SB_43252| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 699 Score = 31.9 bits (69), Expect = 0.34 Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Frame = +2 Query: 146 MKSTMEDEKLKEKISDSDKQTILDKCNDTIKW-LDSNQLADKEEYEHKQKELEGICNPII 322 +++ + EK K + D +++ L + T+K+ LD +LA KE++ +KE EG + Sbjct: 100 VENDRDSEKHKRDLRDKEQE--LSELRKTVKYALDQEKLA-KEQFGDLKKEFEGYKKKMD 156 Query: 323 TKMYQXCRRSPRRYA 367 TKM Q +R +++ Sbjct: 157 TKM-QLLQREKLKFS 170 >SB_3733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1755 Score = 31.9 bits (69), Expect = 0.34 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 1/78 (1%) Frame = +2 Query: 59 NEAEKYRN-EDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTI 235 N EK +N E K K + + A E S++ ++ E+ EK ++T D+ N TI Sbjct: 1658 NNHEKEQNIESIKDKLWAEFEEAKED---SVREALDSER--EKWRKEYEKTTQDEINKTI 1712 Query: 236 KWLDSNQLADKEEYEHKQ 289 +L+ EE++HK+ Sbjct: 1713 SYLEDQYTRGLEEFKHKE 1730 >SB_3809| Best HMM Match : DUF1014 (HMM E-Value=8.7e-09) Length = 265 Score = 31.5 bits (68), Expect = 0.46 Identities = 24/97 (24%), Positives = 47/97 (48%) Frame = +2 Query: 17 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 196 +K R +EE +++ + +K+ ++ K+ E ++ KNA E++ LK K S+S Sbjct: 50 EKERKEREEEDKLWEDDDKHEQQEKKRLEALERKNAARQML-----EEEEKSLKGKTSNS 104 Query: 197 DKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGI 307 + + + +LA ++E KQK+ E I Sbjct: 105 SAKMTRAQITE-----HQAKLAAEQEKLQKQKQQETI 136 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 31.5 bits (68), Expect = 0.46 Identities = 25/101 (24%), Positives = 51/101 (50%), Gaps = 3/101 (2%) Frame = +2 Query: 8 ITNDKGRLSKEEIER--MVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKE 181 ITN G++ KEE +R V E++K K++E I+ K A + E++++KE Sbjct: 1145 ITNAMGKIEKEEAKRKAAVEESQKAIEAARKKQEEIRQKQAA-----WRQQEEEEQRVKE 1199 Query: 182 KISD-SDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 301 ++ +++ ++ N L + + + E K+K++E Sbjct: 1200 RLQILREERERIEALNKEADLLIQRRKEAERKAEEKRKQIE 1240 >SB_40384| Best HMM Match : Filament (HMM E-Value=0.76) Length = 563 Score = 31.1 bits (67), Expect = 0.60 Identities = 23/94 (24%), Positives = 39/94 (41%) Frame = +2 Query: 17 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 196 DK RL KE + R+ A ++R +KQ + E+ + + +K E I + Sbjct: 195 DKDRLKKEMVLRLNQVAAEFRKVSNKQMAETTKRTIRENVSINAQLAKMSDKTMELIQE- 253 Query: 197 DKQTILDKCNDTIKWLDSNQLADKEEYEHKQKEL 298 ND ++ + Q + EH +KEL Sbjct: 254 ---------NDELRAKEKKQKLQIDMLEHNEKEL 278 >SB_17273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 31.1 bits (67), Expect = 0.60 Identities = 12/38 (31%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = +2 Query: 221 CNDTIKWLDSN-QLADKEEYEHKQKELEGICNPIITKM 331 C++ +WL++N A EE ++++L G+ PI++K+ Sbjct: 7 CDEKSEWLENNADTASLEEIVKQKEDLAGVLQPILSKL 44 >SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) Length = 317 Score = 31.1 bits (67), Expect = 0.60 Identities = 17/62 (27%), Positives = 32/62 (51%) Frame = +2 Query: 35 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 214 K E+E+ E EK R E +KQ+ + K LES ++ + + EK + ++ ++ Sbjct: 223 KNEVEKERQEEEKRRMEIEKQRMESEKKRILESKQKRIEESKDTIHDNEKFLEEQRKRLV 282 Query: 215 DK 220 +K Sbjct: 283 EK 284 >SB_57319| Best HMM Match : Pox_A_type_inc (HMM E-Value=6.3e-06) Length = 348 Score = 30.7 bits (66), Expect = 0.80 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +2 Query: 2 ITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKN-ALESYCFSMKSTMEDEK 172 +T D G + EE++R+ NE EK +NE + K+ L++Y + E EK Sbjct: 127 LTSKADYGNIHAEELQRIRNELEKCKNEISDLNSKLNTKSQKLKTYKKHIGELQEREK 184 >SB_54719| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.045) Length = 782 Score = 30.7 bits (66), Expect = 0.80 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 8/77 (10%) Frame = +2 Query: 98 KETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILD------KCNDTIKWL--DSN 253 KE +Q + L ++ + K +E EK+ IS +D + +L+ K + I+ L + + Sbjct: 299 KERLQIERKLANFTKTSKKEVESEKV---ISRTDGKKVLELEKDISKKKNEIRRLRTELS 355 Query: 254 QLADKEEYEHKQKELEG 304 QL + +++H +KELEG Sbjct: 356 QLQENSKHKHFEKELEG 372 >SB_15994| Best HMM Match : Pox_A_type_inc (HMM E-Value=2e-06) Length = 364 Score = 30.7 bits (66), Expect = 0.80 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +2 Query: 2 ITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKN-ALESYCFSMKSTMEDEK 172 +T D G + EE++R+ NE EK +NE + K+ L++Y + E EK Sbjct: 127 LTSKADYGNIHAEELQRIRNELEKCKNEISDLNSKLNTKSQKLKTYKKHIGELQEREK 184 >SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) Length = 703 Score = 30.3 bits (65), Expect = 1.1 Identities = 25/96 (26%), Positives = 45/96 (46%), Gaps = 1/96 (1%) Frame = +2 Query: 17 DKGRLSKEEIERMVNEAEKYRNEDDKQK-ETIQAKNALESYCFSMKSTMEDEKLKEKISD 193 ++ R E R EAE+ R E +K+K E +A+ + + ++E+LK + D Sbjct: 179 EEARKKAEAKARFEQEAERRRREAEKRKAEEEEARRKADELEKIKRQQEDEERLKNQRLD 238 Query: 194 SDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 301 +++ K + L + KEE E K++E E Sbjct: 239 EERK----KLEEEEANLMEEERKRKEEAEKKREEEE 270 >SB_46225| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00052) Length = 649 Score = 30.3 bits (65), Expect = 1.1 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 2/59 (3%) Frame = +2 Query: 35 KEEIERMVNEAEKYRNEDDK-QKETIQAKNALESYCFSMKSTMED-EKLKEKISDSDKQ 205 KE+I+ NEA++ + DK +KE +KN LES +K+ ++ +E I+ ++Q Sbjct: 2 KEDIQVRSNEAQREARKKDKLEKELKTSKNDLESKTAELKTKQSQLQRNQEDIAKLEQQ 60 >SB_12462| Best HMM Match : Kinesin (HMM E-Value=0) Length = 803 Score = 30.3 bits (65), Expect = 1.1 Identities = 18/70 (25%), Positives = 34/70 (48%) Frame = +2 Query: 17 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 196 D+ + + I+R+ N + Y+ E D +E + E Y S++ + KL+++I D Sbjct: 560 DEIKFKTKTIDRLENRLQSYQVEIDDLQEEFERDR--EDYLDSIRKQEQTIKLQQQIIDK 617 Query: 197 DKQTILDKCN 226 + I CN Sbjct: 618 IQPCIRRDCN 627 >SB_42014| Best HMM Match : Myosin_tail_1 (HMM E-Value=0.083) Length = 1007 Score = 29.9 bits (64), Expect = 1.4 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Frame = +2 Query: 35 KEEIERMVNEAEKYRNEDDKQKETIQAKNA-LESYCFSMKSTMEDEKLKEKISDSDKQTI 211 + E+E+ E EK DK+K+ ++ N L S+ S + DE KE +D+ Q I Sbjct: 837 RSELEKAKGEIEKAWTLYDKEKDRLEKLNGQLIDELKSLTSVL-DEMKKESENDAQCQKI 895 Query: 212 LD 217 LD Sbjct: 896 LD 897 >SB_26137| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.27) Length = 271 Score = 29.9 bits (64), Expect = 1.4 Identities = 24/98 (24%), Positives = 48/98 (48%), Gaps = 1/98 (1%) Frame = +2 Query: 11 TNDKGRLSKE-EIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKI 187 T + + KE + E+ ++ + E + Q E +A+ E+ T E E +EK Sbjct: 144 TEKEAQTEKEAQTEKEAGTEKEAQTEKEAQMEK-EAETEKEAQTEKEAQT-EKEAEREKE 201 Query: 188 SDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 301 ++++K+ +K +T K + + A+ ++ KQKE E Sbjct: 202 AETEKEAKTEKEAETEKEAQTEKEAETQKEAEKQKEAE 239 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 29.9 bits (64), Expect = 1.4 Identities = 18/62 (29%), Positives = 35/62 (56%) Frame = +2 Query: 17 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 196 ++ + KEE ER+ EAE+ R ED++Q+ + + A E +K M+ K + + ++ Sbjct: 411 EEEKRQKEEEERLRVEAERQREEDERQRAEDERQRA-EDERQRVKHEMQRLKDERRRAEE 469 Query: 197 DK 202 D+ Sbjct: 470 DE 471 Score = 29.9 bits (64), Expect = 1.4 Identities = 24/102 (23%), Positives = 52/102 (50%), Gaps = 5/102 (4%) Frame = +2 Query: 11 TNDKGRLSKEE---IERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLK- 178 T ++ R ++EE I R EAE+ R E +++++ + +ALE C + + ++K Sbjct: 508 TEERERQAREEEDRIRREREEAERLRREKEQREQLVPHSDALE--CAIKPLNLLEARIKA 565 Query: 179 EKISDSDKQTILDKCNDTIK-WLDSNQLADKEEYEHKQKELE 301 +K+ + ++ + +K + +L +K + E Q+E E Sbjct: 566 QKLEEEQRELERLQAEAELKRKQELERLREKRKEEKAQRERE 607 >SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) Length = 442 Score = 29.9 bits (64), Expect = 1.4 Identities = 22/80 (27%), Positives = 38/80 (47%) Frame = +2 Query: 35 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 214 K+E ER+ +AEK + K+KE ++ K E K E+EK K++ + K Sbjct: 349 KKEQERLEKQAEK----EKKEKERLEKKQREEKDRLEKKEKKEEEKRKKEEEINAKIEEK 404 Query: 215 DKCNDTIKWLDSNQLADKEE 274 K + K + ++ KE+ Sbjct: 405 KKREEKKKQEEEEKMKKKEQ 424 >SB_21264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 29.9 bits (64), Expect = 1.4 Identities = 24/95 (25%), Positives = 44/95 (46%), Gaps = 2/95 (2%) Frame = +2 Query: 17 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 196 DK + KE+ E M E +K D + KE + + + M +E+ KE++ Sbjct: 21 DKEEMDKEDKEDM-EEMDK-EEMDQQDKEEMDQEEMDKKDKEDMDQEDMEEQDKEEMEQK 78 Query: 197 DKQTILDKCNDTIKWLDSNQL--ADKEEYEHKQKE 295 DK+ + ++ + + D + DKEE + + KE Sbjct: 79 DKEDMDEQDKEDMDKQDKEDMDKQDKEEMDKQDKE 113 >SB_58958| Best HMM Match : Baculo_PEP_C (HMM E-Value=0.35) Length = 1076 Score = 29.5 bits (63), Expect = 1.8 Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = -3 Query: 384 LRPGS-PAYLRGLLRHXWYIFVIIGLQM 304 L+PG+ PA + L++H W+ F +I M Sbjct: 275 LKPGADPAVVNNLMKHSWFFFELIAKSM 302 >SB_54255| Best HMM Match : DUF329 (HMM E-Value=7.8) Length = 82 Score = 29.5 bits (63), Expect = 1.8 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = +2 Query: 149 KSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKEL 298 K T ED++ ++K ++SD Q + N T K +L + +E K+ EL Sbjct: 33 KVTQEDQEPEKKSNESDPQKDQETDNKTSKKESQEELREADETPKKKDEL 82 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 29.5 bits (63), Expect = 1.8 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = +1 Query: 388 PEPEVPPPGLEALAPPSRRSIKP-TFHTTRKPTCNNHLVTSP 510 P+P+ PPPG PPS + P T +P VT P Sbjct: 28 PKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQP 69 >SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2193 Score = 29.5 bits (63), Expect = 1.8 Identities = 20/60 (33%), Positives = 30/60 (50%) Frame = +2 Query: 17 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 196 DK +L KEE E+ + E NE KQKE +A++ L++ + D K E D+ Sbjct: 1606 DKYQLEKEEAEKRLQSYEDELNEKQKQKE--KAEDNLKALKKRISDLEVDNKNLETARDN 1663 >SB_32331| Best HMM Match : DivIVA (HMM E-Value=0.86) Length = 888 Score = 29.1 bits (62), Expect = 2.4 Identities = 25/118 (21%), Positives = 55/118 (46%) Frame = +2 Query: 2 ITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKE 181 + I +D G L ++ N+ +K E+D+ +E + E++ SM+ + D++ +E Sbjct: 619 VKIYDDDGDLKVSKLTGFFNDDDKEEEEEDRAEECEET----EAHIISMQEEVNDDETEE 674 Query: 182 KISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGICNPIITKMYQXCRRSP 355 + +D + D ++ ++ D E E K +L+ C+ I T ++ + P Sbjct: 675 E-ADMEGYD-----EDIVELQPQDEEEDGEVIEGKLDDLQTQCH-INTGSHEAIHQPP 725 >SB_29377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 29.1 bits (62), Expect = 2.4 Identities = 21/93 (22%), Positives = 46/93 (49%), Gaps = 1/93 (1%) Frame = +2 Query: 17 DKGRLSKEEIERMVNEAEKYRNED-DKQKETIQAKNALESYCFSMKSTMEDEKLKEKISD 193 DK R +E +R E ++ R++D DK+++ + + + + +K +++ D Sbjct: 353 DKDRDRDKERDR---EKDRERDKDRDKERDRDKDREREKDRDKERDRDKDRDKERDRDKD 409 Query: 194 SDKQTILDKCNDTIKWLDSNQLADKEEYEHKQK 292 DK+ D+ D K D ++ D++ + K+K Sbjct: 410 RDKERDRDRDRDRDKERDKDRHRDRDRRDRKEK 442 Score = 28.3 bits (60), Expect = 4.2 Identities = 25/96 (26%), Positives = 44/96 (45%), Gaps = 1/96 (1%) Frame = +2 Query: 17 DKGRLSKEEIERMVNEAEKYRNED-DKQKETIQAKNALESYCFSMKSTMEDEKLKEKISD 193 D+GR S ER E +K R++D D+++E K+ + +K ++K D Sbjct: 306 DEGRSS----ERREKEEKKSRDKDKDRERERKDKKDRDRG----RNKDRDRDKERDKDRD 357 Query: 194 SDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 301 DK+ +K + K D + DK+ K ++ E Sbjct: 358 RDKERDREKDRERDKDRDKERDRDKDREREKDRDKE 393 >SB_59386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1037 Score = 29.1 bits (62), Expect = 2.4 Identities = 15/41 (36%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = +2 Query: 11 TNDKGRLSKEEIERMVNEAEKY-RNEDDKQKETIQAKNALE 130 TND G S +E E VN ++K NE++ + E ++ +N++E Sbjct: 888 TNDNGS-STDEAESEVNNSDKEGENEENDEVEDMEVENSIE 927 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 29.1 bits (62), Expect = 2.4 Identities = 24/102 (23%), Positives = 45/102 (44%), Gaps = 11/102 (10%) Frame = +2 Query: 20 KGRLSKEEIERMVNEAEKYRNED------DKQKETIQAKNALESYCFSMKSTMEDEKL-- 175 K +++ E +++AE + NED D E A E ++ E E++ Sbjct: 1408 KEEMAEIEKASQIDQAEDFPNEDEVPAVIDLLPENSSAFGISEEKIDGIQEAKESEEIVS 1467 Query: 176 ---KEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQK 292 E+I D D ++D ++ L ++ D+EE E ++K Sbjct: 1468 SGETEEIEDEDTPVVVDILSEDTSALGISEERDEEEIEQQKK 1509 >SB_45987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 29.1 bits (62), Expect = 2.4 Identities = 25/118 (21%), Positives = 56/118 (47%) Frame = +2 Query: 2 ITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKE 181 + I +D G L ++ N+ +K + E+D+ +E + E++ SM+ + D++ +E Sbjct: 976 VKIYDDDGDLKVSKLTGFFNDDDKEKEEEDRAEECEET----EAHIISMQEEVNDDETEE 1031 Query: 182 KISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGICNPIITKMYQXCRRSP 355 ++D + + D + ++ D E E K +L+ C+ I T ++ + P Sbjct: 1032 ---EADMKGYDE---DIVDLQPQDKEEDGEVIEEKLDDLQTQCH-INTGSHEAIHQPP 1082 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 28.7 bits (61), Expect = 3.2 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 1/78 (1%) Frame = +2 Query: 77 RNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQ 256 +N E + + + SY K + EK KEK + +K+ ILD K++ N Sbjct: 1081 KNSQTPLLEILSPRKDIGSYKSCPKLRKKREKEKEKDKEKEKEVILD-FEALDKFIGRNP 1139 Query: 257 LADKEEY-EHKQKELEGI 307 + E+ E + ELE I Sbjct: 1140 MTQIAEFREAEAAELEAI 1157 >SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1128 Score = 28.7 bits (61), Expect = 3.2 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = +1 Query: 364 CRASRAEHPEPEVPPPGLEALAPPSRRSIKPTFHTTRKPT 483 C A A+ P+ +VPPP APP + P TT PT Sbjct: 92 CNAKPAQ-PDTDVPPPPATTSAPPPPTTTAPP-ATTSPPT 129 >SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) Length = 1683 Score = 28.7 bits (61), Expect = 3.2 Identities = 25/94 (26%), Positives = 44/94 (46%), Gaps = 3/94 (3%) Frame = +2 Query: 20 KGRLSKEEIERMVNEAEKYRNEDDKQKETIQ-AKNALESYCFSMKSTMEDEKLKEKISDS 196 K R + +++ + A + + DK + IQ +NA +S +KSTM +K K+ D Sbjct: 512 KIRRLEVQVDNLAQLASSLKKDKDKVSKQIQDLRNATQSAIKKIKSTM----MKRKMIDE 567 Query: 197 DKQTILDKCNDTIKWLDSNQLADK--EEYEHKQK 292 ++ + N + L+ Q K EE E +K Sbjct: 568 VYCDLVKRVNHHLADLNERQKQQKIAEEQERLRK 601 >SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 28.7 bits (61), Expect = 3.2 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 2/67 (2%) Frame = +2 Query: 26 RLSKEEIERMVNEAEKYRNED--DKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSD 199 + K+E ER E EK R ++ ++KE + + E K E ++ KEK+ + + Sbjct: 316 KAKKKEKERQEREKEKEREKERIQQEKEKQKERREKEKQKHQEKKEKERQREKEKL-EKE 374 Query: 200 KQTILDK 220 KQ L++ Sbjct: 375 KQKELER 381 >SB_6748| Best HMM Match : Pkinase (HMM E-Value=1.7e-05) Length = 315 Score = 28.7 bits (61), Expect = 3.2 Identities = 15/57 (26%), Positives = 31/57 (54%) Frame = +2 Query: 20 KGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKIS 190 K ++ K+++++ E ++ DDK KET+ N +ES + E++ E++S Sbjct: 229 KKQIEKQKLQQDEIEQGLLQDSDDKDKETL-GDNCIESNDMEESAKDSSEEISEELS 284 >SB_35866| Best HMM Match : TPR_MLP1_2 (HMM E-Value=0.34) Length = 758 Score = 28.7 bits (61), Expect = 3.2 Identities = 23/103 (22%), Positives = 44/103 (42%), Gaps = 3/103 (2%) Frame = +2 Query: 2 ITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTM---EDEK 172 + + D + I +M + + E+ + + + AK E F ++ M EDE Sbjct: 349 LKVEEDFDEAESDIILQMRTQLDMLAQENFRLQNELDAKRNYEEEYFELRQRMQEAEDEM 408 Query: 173 LKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 301 K + K D ++ I+ L+ L + EYE + +EL+ Sbjct: 409 ASMKHEYATKTGESDFLSERIELLEKEILDMRVEYEGQIRELQ 451 >SB_8304| Best HMM Match : PLAT (HMM E-Value=0) Length = 1182 Score = 28.7 bits (61), Expect = 3.2 Identities = 21/85 (24%), Positives = 47/85 (55%) Frame = +2 Query: 35 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 214 KEE + E EK + ED+ ++E + +E+ +K +EDE K+++ + +K+T Sbjct: 642 KEEERKRREEEEKKKREDEVKREEEGRRQKVEA---ELK-LIEDEH-KQRLEELEKKTKK 696 Query: 215 DKCNDTIKWLDSNQLADKEEYEHKQ 289 ++ + +++++ D+ + E KQ Sbjct: 697 EEEKKRSEHVNNDEELDRLQEEIKQ 721 >SB_54892| Best HMM Match : DHH (HMM E-Value=0.057) Length = 384 Score = 28.3 bits (60), Expect = 4.2 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 2/76 (2%) Frame = +2 Query: 17 DKGRLSKEEIERMVNEAEKYRNED-DKQKETIQAKNALESYCFSMKSTMEDEKLKEKISD 193 DK + + EE+ VNEA K E KQ++T Q+ + + C ++ E+ S+ Sbjct: 156 DKVKFNLEELYHSVNEATKRNTEAIQKQRQTRQSPASPGTICRLYNKKLDFEQFDYGFSE 215 Query: 194 SDKQTI-LDKCNDTIK 238 + K + +D TIK Sbjct: 216 TIKGLLCVDVSAVTIK 231 >SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2520 Score = 28.3 bits (60), Expect = 4.2 Identities = 26/92 (28%), Positives = 44/92 (47%), Gaps = 6/92 (6%) Frame = +2 Query: 35 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS-----D 199 + +E +NE EK D + Q KN E C + +T E +K +++S+S + Sbjct: 805 RAHLESDINEKEKEIERKDNALKEFQEKNK-ELEC-QLAATGELKKTVDELSNSITLRDE 862 Query: 200 KQT-ILDKCNDTIKWLDSNQLADKEEYEHKQK 292 K T I ++ T++ + A KEE K+K Sbjct: 863 KITKIKEQLKQTLEKFKEKEKALKEEIAEKEK 894 >SB_49603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 28.3 bits (60), Expect = 4.2 Identities = 25/96 (26%), Positives = 40/96 (41%), Gaps = 5/96 (5%) Frame = +2 Query: 8 ITNDKGRLSKEEIERMVNEAEKYRNEDDK-QKETI---QAKNALESYCFSM-KSTMEDEK 172 + DKG K ++E EKY E+DK KE + K E Y K E Sbjct: 66 LEEDKGNKEKYDLEEDKGNKEKYDLEEDKGNKEKYDLEEDKGNKEKYDLEEDKGNKEKYD 125 Query: 173 LKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYE 280 L+E + +K + + + K+ +KE+Y+ Sbjct: 126 LEEDKGNKEKYDLEEDKGNKEKYDLEEDKGNKEKYD 161 >SB_44787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 28.3 bits (60), Expect = 4.2 Identities = 15/52 (28%), Positives = 28/52 (53%) Frame = +2 Query: 35 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKIS 190 K+E R+ +EAEK E++K K+ + + + Y ++ + K K+K S Sbjct: 467 KDEQSRLFDEAEKLEKENNKLKDEVGSLSKEIEYLKNLMLEVYQTKQKQKES 518 >SB_33744| Best HMM Match : SMC_N (HMM E-Value=0) Length = 1014 Score = 28.3 bits (60), Expect = 4.2 Identities = 24/93 (25%), Positives = 42/93 (45%) Frame = +2 Query: 29 LSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQT 208 L EEI+ + N ++ + +K KETI A D +LK K + + ++ Sbjct: 561 LQLEEIKTLENNLDEQQQLIEKSKETIALATA----------KCNDIELKMKEAKTYRER 610 Query: 209 ILDKCNDTIKWLDSNQLADKEEYEHKQKELEGI 307 L K + +K +E + KQ+E+EG+ Sbjct: 611 ELKKAEEDLKKAKKRAEQSIKETKTKQQEVEGM 643 >SB_23940| Best HMM Match : MuDR (HMM E-Value=0.24) Length = 685 Score = 28.3 bits (60), Expect = 4.2 Identities = 25/118 (21%), Positives = 55/118 (46%) Frame = +2 Query: 2 ITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKE 181 + I +D G L ++ N+ +K E+D+ +E + E++ SM+ + D++ +E Sbjct: 449 VKIYDDDGDLKVSKLTGFFNDDDKEEEEEDRAEECEET----EAHIISMQEEVNDDETEE 504 Query: 182 KISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGICNPIITKMYQXCRRSP 355 ++D + + D + ++ D E E K +L+ C+ I T ++ + P Sbjct: 505 ---EADMKGYDE---DIVDLQPQDKEEDGEVIEEKLDDLQTQCH-INTGSHEAIHQPP 555 >SB_3878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 243 Score = 28.3 bits (60), Expect = 4.2 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 6/86 (6%) Frame = +2 Query: 35 KEEIERM--VNEAEKYRN-EDDKQKETIQAK--NALESYCFSMKSTMEDEKLKEKISDSD 199 KEEIE NE E+ EDD +KE I+ + + + + E+E+++E+ D D Sbjct: 157 KEEIEEREDANEKEEIEEREDDNEKEEIEEREDDNEKEEIDEREDDNEEEEIEEREDDDD 216 Query: 200 KQTILDKC-NDTIKWLDSNQLADKEE 274 + D+ ND + + ++ D + Sbjct: 217 EVEERDETENDNDEGEEREEMEDDND 242 >SB_52390| Best HMM Match : Cauli_DNA-bind (HMM E-Value=6.4) Length = 232 Score = 28.3 bits (60), Expect = 4.2 Identities = 25/118 (21%), Positives = 55/118 (46%) Frame = +2 Query: 2 ITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKE 181 + I +D G L ++ N+ +K E+D+ +E + E++ SM+ + D++ +E Sbjct: 88 VKIYDDDGDLKVSKLTGFFNDDDKEEEEEDRAEECEET----EAHIISMQEEVNDDETEE 143 Query: 182 KISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGICNPIITKMYQXCRRSP 355 ++D + + D + ++ D E E K +L+ C+ I T ++ + P Sbjct: 144 ---EADMKGYDE---DIVDLQPQDKEEDGEVIEEKLDDLQTQCH-INTGSHEAIHQPP 194 >SB_48270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 28.3 bits (60), Expect = 4.2 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 7/79 (8%) Frame = +2 Query: 128 ESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQL----ADKEEY---EHK 286 ESYC + K + S DK+T K K +D+ L A KE+Y E K Sbjct: 49 ESYCKAGKPEVNSNNNNNLFSVDDKRTTFIKKLMGDKTIDAESLRLKAAMKEQYKALEQK 108 Query: 287 QKELEGICNPIITKMYQXC 343 K+L+ C+ + + C Sbjct: 109 YKKLQEKCDQTVIEFNYKC 127 >SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.3 bits (60), Expect = 4.2 Identities = 21/93 (22%), Positives = 48/93 (51%), Gaps = 1/93 (1%) Frame = +2 Query: 20 KGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSD 199 K + K++ ++ N+ K +K+K+ ++ K E+ + T+E E +EKI +++ Sbjct: 26 KKKKKKKKKKKKKNKKNKKNKNKNKKKKKMKKKKEEEAEVG--EKTLEAENEEEKIEETE 83 Query: 200 KQ-TILDKCNDTIKWLDSNQLADKEEYEHKQKE 295 K+ +K + K + ++EE E +++E Sbjct: 84 KEKDEEEKIEEEEKEGGEEENEEEEEEETEEEE 116 >SB_24447| Best HMM Match : TolA (HMM E-Value=1.3) Length = 325 Score = 28.3 bits (60), Expect = 4.2 Identities = 26/107 (24%), Positives = 57/107 (53%), Gaps = 11/107 (10%) Frame = +2 Query: 14 NDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESY--------CFSMKSTMEDE 169 N + ++ KE+ +M+ ++ K RN+ + + ++N L++Y S + DE Sbjct: 84 NRELKVLKEDYAKMIVKSYKSRNDQSRVMFVLSSQNFLQAYKRIQYMKQYASFRKMQGDE 143 Query: 170 --KLKEKISDSD-KQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 301 + ++K++++ KQ + K + K L+ N+ A+K E E ++K+ E Sbjct: 144 IAEKQDKLAEAKIKQEVSKKSKE--KALEENK-AEKIELESQKKDQE 187 >SB_23774| Best HMM Match : Kinesin (HMM E-Value=0) Length = 805 Score = 28.3 bits (60), Expect = 4.2 Identities = 17/55 (30%), Positives = 31/55 (56%) Frame = +2 Query: 38 EEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDK 202 EE+E + + E+ R+ + Q ET++ +N E K T E++ LKE I+ ++ Sbjct: 54 EELEDRIAKLEEERDNLEVQLETVRKENDTE----MEKQTNENDTLKETITGHEE 104 >SB_7914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 28.3 bits (60), Expect = 4.2 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +2 Query: 161 EDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKE 295 EDE+ E SD D +T +++ +D ++ D+EE HK +E Sbjct: 118 EDEEKTESESDDDDKTEKYSDDESDVSMDGDESDDEEEGPHKPEE 162 >SB_47024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 975 Score = 27.9 bits (59), Expect = 5.6 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 1/86 (1%) Frame = +2 Query: 47 ERMVNEAEKYRNED-DKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKC 223 E++ E E+Y +QKE + K + + ++KS E+ K KEK+S ++Q L+ Sbjct: 123 EQLQLERERYATASLTQQKEALSEKLSQITLRQNLKSHKEEAKNKEKLS-KERQKKLENM 181 Query: 224 NDTIKWLDSNQLADKEEYEHKQKELE 301 + + EE +QKE+E Sbjct: 182 LQSERQRCVEYQRLYEEQVLRQKEME 207 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 27.9 bits (59), Expect = 5.6 Identities = 16/59 (27%), Positives = 32/59 (54%) Frame = +2 Query: 119 NALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKE 295 +AL+ Y + ++ EKLKE I D K +LD+ ++W+ + ++ + ++KE Sbjct: 852 SALDLYVLIPPANIK-EKLKEDIHDPHK--VLDRVKYRVEWVKHQEKEKQKLEDEREKE 907 >SB_40334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1061 Score = 27.9 bits (59), Expect = 5.6 Identities = 16/62 (25%), Positives = 30/62 (48%) Frame = +2 Query: 14 NDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISD 193 +D ++ EE E ++AE E D++ +A ++ S +D++L EK+ D Sbjct: 975 SDASHVTSEE-EMQASDAESEEKEKDEESSDAEAPSSSRKRVISSD---DDDELDEKLDD 1030 Query: 194 SD 199 D Sbjct: 1031 DD 1032 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 27.9 bits (59), Expect = 5.6 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 403 PPPGLEALAPPSRRSIKPTFHTTRKPTCNNHLVTSP 510 PPP A PP R S P TR P N+ P Sbjct: 263 PPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGP 298 >SB_32124| Best HMM Match : K-box (HMM E-Value=4.1) Length = 207 Score = 27.9 bits (59), Expect = 5.6 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 3/68 (4%) Frame = +2 Query: 35 KEEIERMVNEAEKYRNE-DDKQKETIQAKNALESYCFSMKSTMEDEKLKEKIS--DSDKQ 205 K +IE + E + E DD Q+ET K L SY MKS +K ++ +S+ + Sbjct: 137 KIKIEELEVRIEDLKEENDDYQQETKYLKQVL-SYREDMKSVQVSQKATRQLQKLESNLE 195 Query: 206 TILDKCND 229 KC D Sbjct: 196 DAEKKCKD 203 >SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 903 Score = 27.9 bits (59), Expect = 5.6 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = +2 Query: 35 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQ 205 +EE ER E K E+ KQ+E + K E + E+E+ K+K + +K+ Sbjct: 448 REEEERREEEERKREEEERKQREEEEKKREEEE-----RKQREEEERKQKEKEEEKK 499 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 27.9 bits (59), Expect = 5.6 Identities = 16/51 (31%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = +1 Query: 388 PEPEVPPPGLEALAPPSRRS--IKPTFHTTRKPTCNNHLVTSP*LK*INIE 534 P P PPPG E PP + + PT P V+ P K N++ Sbjct: 132 PPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPPTGGSCVSKPPYKSANMD 182 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 27.9 bits (59), Expect = 5.6 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 403 PPPGLEALAPPSRRSIKPTFHTTRKPTCNNHLVTSP 510 PPP A PP R S P TR P N+ P Sbjct: 175 PPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGP 210 >SB_3000| Best HMM Match : Extensin_2 (HMM E-Value=0.058) Length = 1002 Score = 27.9 bits (59), Expect = 5.6 Identities = 21/74 (28%), Positives = 34/74 (45%) Frame = +2 Query: 5 TITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEK 184 T N+K +L ++E+ER + E ++E + A + S E KLKE+ Sbjct: 677 TERNEKAKLHRQELERKMQEEAMKKHETELD---YLAPFLAQIGDPPRISRQEAYKLKEE 733 Query: 185 ISDSDKQTILDKCN 226 KQ ++DK N Sbjct: 734 CLQDLKQRLIDKAN 747 >SB_1305| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.8e-11) Length = 1491 Score = 27.9 bits (59), Expect = 5.6 Identities = 21/98 (21%), Positives = 49/98 (50%), Gaps = 10/98 (10%) Frame = +2 Query: 68 EKYRNEDDKQKETIQAKNALESYCFSMKSTMEDE--KLKEKIS-DSDKQTILDKCNDTIK 238 E R ++K K ++A N E KS+ ++ L+ + + +++T L++ N +++ Sbjct: 299 ELLRKAEEKSKSKMKAINDYEIQILDFKSSFSEQISTLEAALQHEQEQKTRLEELNISLR 358 Query: 239 WLDSNQLADKEEY-------EHKQKELEGICNPIITKM 331 + L + +E + ++KELE IC+ + ++ Sbjct: 359 GDNEAILREVDEMKRALLLAQEREKELEAICSQEVCRL 396 >SB_40368| Best HMM Match : SASP_gamma (HMM E-Value=2.3) Length = 325 Score = 27.9 bits (59), Expect = 5.6 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 5/42 (11%) Frame = +1 Query: 376 RAEHPEPEVPPPGLEALAPPSRRSIKPTFHT-----TRKPTC 486 R+ PE PP L+ LA P+ + +P+ T R PTC Sbjct: 28 RSRETPPETPPVQLKHLAGPAEKPHRPSRETPPVQPRRNPTC 69 >SB_31962| Best HMM Match : DUF1168 (HMM E-Value=1.5) Length = 205 Score = 27.9 bits (59), Expect = 5.6 Identities = 19/88 (21%), Positives = 40/88 (45%) Frame = +2 Query: 38 EEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILD 217 EE E E E+ E+++Q E + + E + + E+EK + K D +++ + D Sbjct: 72 EEEEEQTEEEEEQTEEEEEQTEEEEEQTEEEEEQ-TEEEEEEEEKEEGKEEDGEEEVVTD 130 Query: 218 KCNDTIKWLDSNQLADKEEYEHKQKELE 301 + + +SN+ + E + + E Sbjct: 131 ERGISSSKDESNESDESNESDESNESDE 158 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 27.9 bits (59), Expect = 5.6 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = +1 Query: 388 PEPEVPPPGLE-ALAPPSRRSIKPTFH 465 P P PPP L A APP R P H Sbjct: 425 PPPPPPPPALRLACAPPRLRFTSPVLH 451 >SB_11774| Best HMM Match : M (HMM E-Value=8.5e-09) Length = 1998 Score = 27.9 bits (59), Expect = 5.6 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = +2 Query: 38 EEIERMVNE-AEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISD 193 E+ E+++ + AEK R +K+KE + E F + + +DE L +K+ D Sbjct: 1446 EKREKVLQDGAEKDRKGFEKEKEEFEEAFRKEKKIFQDELSKKDEDLAQKLQD 1498 >SB_11244| Best HMM Match : M (HMM E-Value=2.5e-08) Length = 1381 Score = 27.9 bits (59), Expect = 5.6 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 3/68 (4%) Frame = +2 Query: 35 KEEIERMVNEAEKYRNE-DDKQKETIQAKNALESYCFSMKSTMEDEKLKEKIS--DSDKQ 205 K +IE + E + E DD Q+ET K L SY MKS +K ++ +S+ + Sbjct: 874 KIKIEELEVRIEDLKEENDDYQQETKYLKQVL-SYREDMKSVQVSQKATRQLQKLESNLE 932 Query: 206 TILDKCND 229 KC D Sbjct: 933 DAEKKCKD 940 >SB_49860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 27.5 bits (58), Expect = 7.4 Identities = 21/91 (23%), Positives = 47/91 (51%) Frame = +2 Query: 29 LSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQT 208 L KE ++R+ ++ + E K+++ ++ +E + E+E++KE++ +KQ Sbjct: 259 LLKELLKRVADKRAEEEEEKRKREKELEMLRQIEE---KKRKLEEEERIKEEV---EKQK 312 Query: 209 ILDKCNDTIKWLDSNQLADKEEYEHKQKELE 301 + K K L L + +E + +++ELE Sbjct: 313 KI-KLEQQEKELRDKLLKNLKEMKERKQELE 342 >SB_33413| Best HMM Match : DUF81 (HMM E-Value=0.31) Length = 455 Score = 27.5 bits (58), Expect = 7.4 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = +2 Query: 164 DEKLKEKISDSDKQTILDKCND 229 D +++ ++ D D+QT+ D C+D Sbjct: 378 DVEVRRRVQDIDRQTVTDDCDD 399 >SB_23579| Best HMM Match : PspA_IM30 (HMM E-Value=1.5) Length = 207 Score = 27.5 bits (58), Expect = 7.4 Identities = 23/114 (20%), Positives = 48/114 (42%), Gaps = 3/114 (2%) Frame = +2 Query: 41 EIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDK 220 +I +MVN + +D + E + ++ K M+ L +++ +K +D+ Sbjct: 23 KIVQMVNNTARVTRKDARDTEA----SCVDVSLSVRKKNMDILHLNDEVKRYEKLLAMDR 78 Query: 221 CNDTIKWLDSNQLADKEEYEHKQKELEGICNPIIT---KMYQXCRRSPRRYAGL 373 L+ + E EHK +ELE + ++ K + R+ ++Y L Sbjct: 79 KLPRRSILEERLGRAEAELEHKDRELENLHKQVVVADKKAAREIRKENKKYQKL 132 >SB_17208| Best HMM Match : RVT_1 (HMM E-Value=6.4e-19) Length = 1053 Score = 27.5 bits (58), Expect = 7.4 Identities = 20/81 (24%), Positives = 35/81 (43%) Frame = +2 Query: 44 IERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKC 223 + ++ A KY N+DD A L S+ + KEK+S+ ++ I+ K Sbjct: 623 VNQVEKAASKY-NDDDDATHAYFASVELRKLPISLLGPV-----KEKLSEMEQDGIIVKD 676 Query: 224 NDTIKWLDSNQLADKEEYEHK 286 + W+ S + DK + K Sbjct: 677 KEQTPWVSSMLVVDKRREKGK 697 >SB_51904| Best HMM Match : CH (HMM E-Value=0.0058) Length = 1187 Score = 27.5 bits (58), Expect = 7.4 Identities = 26/100 (26%), Positives = 47/100 (47%), Gaps = 4/100 (4%) Frame = +2 Query: 38 EEIERMVNEAEKYRNEDDKQKETIQA----KNALESYCFSMKSTMEDEKLKEKISDSDKQ 205 ++ ++ A + D +++E +++ KN ES ++ +E+EK KE +D + Sbjct: 1052 DKCAELMKRANEATIRDARRREILESWANKKNHTESQIEKVREKVEEEKAKE---PNDYK 1108 Query: 206 TILDKCNDTIKWLDSNQLADKEEYEHKQKELEGICNPIIT 325 T DK LD Q A + ++ KQ L + PI T Sbjct: 1109 TAKDK-------LDRAQSAGESTFKSKQ-SLHPVAKPIPT 1140 >SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3934 Score = 27.5 bits (58), Expect = 7.4 Identities = 15/48 (31%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +2 Query: 65 AEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISD-SDKQ 205 AEKY +E ++K+ ++ LES + + E L++K+S+ S+K+ Sbjct: 2091 AEKYEHESQEKKKIVEISETLESKNRKQQELL--ESLEKKLSEFSEKE 2136 >SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) Length = 418 Score = 27.5 bits (58), Expect = 7.4 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +2 Query: 38 EEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK 172 E E + N+ ++ +DDK++ET K + + S EDEK Sbjct: 40 EAAEEVENKMDEMSVKDDKREETQSDKKSAKESTKSSSKPAEDEK 84 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 27.5 bits (58), Expect = 7.4 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 8/48 (16%) Frame = +2 Query: 179 EKISDSDKQTILDKCNDTIKWL--------DSNQLADKEEYEHKQKEL 298 E I S+ +L+ C D + W+ DS+ ++KEE E +++EL Sbjct: 705 EGIDVSELLEVLEPCGDAVLWIRIQSMDAEDSSSDSEKEEEEEEEEEL 752 >SB_18255| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1457 Score = 27.5 bits (58), Expect = 7.4 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +2 Query: 35 KEEIERMVNEAEKYRNEDDKQKETIQ-AKNALESYCFSMKSTMEDEKLKEKISDSDK 202 KE E +NE +KY N+ K +Q KNAL+ + S D L K + ++ Sbjct: 811 KERSEAWLNEKQKYTNDIKHIKTEVQLCKNALDGTKQKVLSLENDLLLTSKQLEKER 867 >SB_3240| Best HMM Match : Sec8_exocyst (HMM E-Value=0.48) Length = 643 Score = 27.5 bits (58), Expect = 7.4 Identities = 18/52 (34%), Positives = 24/52 (46%) Frame = +2 Query: 26 RLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKE 181 R S EE+ R E E E K +ETIQ N E MK + D+ ++ Sbjct: 380 RASVEELVRTRKELEMKEKELQKAQETIQQMNEREQ---QMKERLADQAQRQ 428 >SB_58677| Best HMM Match : Pkinase (HMM E-Value=2.8e-33) Length = 834 Score = 27.1 bits (57), Expect = 9.8 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +2 Query: 38 EEIERMVNEAEKYRNEDDKQKETIQAKNALE 130 + I + + EKYRNE D K+T+ + L+ Sbjct: 720 QAISDFMQKDEKYRNESDDLKKTVYSTKKLQ 750 >SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) Length = 3071 Score = 27.1 bits (57), Expect = 9.8 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ITITNDKGRLSKEEIERMVNEAE-KYRNEDDKQKETIQAKNALESYCFSMKSTMED 166 I + N+ + SKE++ER V AE + R+ D + K +++LE S +++D Sbjct: 1040 ILVENENLKGSKEDLERRVVVAENRLRDTDSEMKGWRDIRSSLERDLQSRDHSIDD 1095 >SB_49873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 27.1 bits (57), Expect = 9.8 Identities = 14/51 (27%), Positives = 21/51 (41%) Frame = +2 Query: 77 RNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCND 229 R++ D +K+ I ++ YC K T D D D LD +D Sbjct: 6 RSKIDAEKDGIHVPTTVQEYCVKAKPTKSDSDDFNDFYDDDYADDLDDDDD 56 >SB_16769| Best HMM Match : DUF1690 (HMM E-Value=0.17) Length = 837 Score = 27.1 bits (57), Expect = 9.8 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = +2 Query: 2 ITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKS 154 + K + +EE E AE DD Q++ +A ALE+ S+KS Sbjct: 149 VVANETKTVVQREEAEAAKKAAETQAIADDAQRDLDEALPALEAALASLKS 199 >SB_12881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 914 Score = 27.1 bits (57), Expect = 9.8 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 149 KSTMEDEKLKEKISDSDKQTILDKCNDT 232 +S EDEK+ SDS+ + LD C+ T Sbjct: 257 RSASEDEKISLHFSDSEGSSSLDHCSLT 284 >SB_56568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 27.1 bits (57), Expect = 9.8 Identities = 18/98 (18%), Positives = 44/98 (44%) Frame = +2 Query: 35 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 214 +++ M ++ Y + +DK + + +L +K +ED K+ + + K + Sbjct: 114 EDKCRSMKDKLGHYDDLEDKVYRYERERKSLTKENKELKEELEDLKISKNELEEKKLGLE 173 Query: 215 DKCNDTIKWLDSNQLADKEEYEHKQKELEGICNPIITK 328 K I+ L+ + +++Y +KE E + + + K Sbjct: 174 KKKTSEIEDLEKERNEAEKKYNSLRKEKENLVSELTKK 211 >SB_49663| Best HMM Match : TolA (HMM E-Value=0.059) Length = 591 Score = 27.1 bits (57), Expect = 9.8 Identities = 13/53 (24%), Positives = 28/53 (52%) Frame = +2 Query: 53 MVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTI 211 M + E+ + + K++E Q + E +++ + E LKE + + +K+TI Sbjct: 182 MRKKEEERMSRERKERERRQQEFIKEQKDVAVQQKAQQESLKETLQEQEKETI 234 >SB_35403| Best HMM Match : Lectin_C (HMM E-Value=1e-05) Length = 2293 Score = 27.1 bits (57), Expect = 9.8 Identities = 25/103 (24%), Positives = 48/103 (46%), Gaps = 7/103 (6%) Frame = +2 Query: 8 ITNDKGRLSKEEIERM--VNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKE 181 + D + S ++ E+ VN+ E R+ DDK+K K+ + + +D++ + Sbjct: 388 VNRDDSQSSIDDKEKRPDVNKDESQRSRDDKEKRPDINKD-------DSQRSRDDKEKRP 440 Query: 182 KISDSDKQTILD---KCNDTIKWLDSN--QLADKEEYEHKQKE 295 ++ D Q+ +D K D K + +A K+ Y +K KE Sbjct: 441 DVNKDDSQSSIDDKEKRPDVNKQKNEKYMNVASKDHYMNKDKE 483 >SB_32504| Best HMM Match : TolA (HMM E-Value=0.52) Length = 422 Score = 27.1 bits (57), Expect = 9.8 Identities = 18/66 (27%), Positives = 33/66 (50%) Frame = +2 Query: 11 TNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKIS 190 T + L +++I R +++K E+ K+KE + K + + K E EK KEK Sbjct: 112 TENHSLLEEKDIPRD-KKSDKELKEEKKEKEKERMKKEEKHKEKTRKEEKEREKEKEKTK 170 Query: 191 DSDKQT 208 +K++ Sbjct: 171 KEEKES 176 >SB_31142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 745 Score = 27.1 bits (57), Expect = 9.8 Identities = 21/94 (22%), Positives = 41/94 (43%), Gaps = 5/94 (5%) Frame = +2 Query: 35 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQ--- 205 K E+ E+ +E D+Q ++ + E K E++KLKE+I + ++ Sbjct: 162 KRACEKHAEHMEQLDDELDQQMSRLEMRIKKELENKIKKKEPEEQKLKEEIEEKVQELRY 221 Query: 206 --TILDKCNDTIKWLDSNQLADKEEYEHKQKELE 301 + + T+ + S K +YE + +LE Sbjct: 222 LRSQVTDAQTTVAVIRSELAQLKNDYEDQSSQLE 255 >SB_23985| Best HMM Match : CRAM_rpt (HMM E-Value=3.4) Length = 323 Score = 27.1 bits (57), Expect = 9.8 Identities = 17/81 (20%), Positives = 40/81 (49%) Frame = +2 Query: 59 NEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIK 238 NE++K RNE D+ E ++ + ES + ++ ++ ++SD+ D+ N++ + Sbjct: 141 NESDK-RNESDESDEDDESNGSDESNESDESNGSDESNGSDESNESDESNESDESNESDE 199 Query: 239 WLDSNQLADKEEYEHKQKELE 301 +S++ +E + E Sbjct: 200 SNESDESNGSDESNESDESNE 220 >SB_6619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 942 Score = 27.1 bits (57), Expect = 9.8 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 7/54 (12%) Frame = +2 Query: 149 KSTMEDEKLKEKISDSDK-------QTILDKCNDTIKWLDSNQLADKEEYEHKQ 289 K T + EK KEKI +K QT+LDK + + + +L K ++HK+ Sbjct: 837 KGTEKQEKEKEKIQKEEKEPEKSKVQTLLDKLHRQARVEEEVKLVLKVYFKHKE 890 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,374,791 Number of Sequences: 59808 Number of extensions: 312037 Number of successful extensions: 1816 Number of sequences better than 10.0: 104 Number of HSP's better than 10.0 without gapping: 1538 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1784 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1227799733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -