BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_P21 (539 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeot... 26 0.93 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 24 3.7 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 24 3.7 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 24 3.7 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 23 5.0 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 5.0 X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein... 23 8.7 >AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeotic protein protein. Length = 308 Score = 25.8 bits (54), Expect = 0.93 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +2 Query: 14 NDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALES 133 N++ R +EE ++M NE+ K + QK+ Q + S Sbjct: 204 NEQARREREEQDKMKNESLKSAQQHHSQKQAQQEHTVVGS 243 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.8 bits (49), Expect = 3.7 Identities = 14/79 (17%), Positives = 33/79 (41%) Frame = +2 Query: 59 NEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIK 238 + A++Y + D + + + +++ + ++ + S ++ + N+ Sbjct: 164 SSADRYSADTDSKLRSERIRDSRDERDSLPNASSNNSNNNNNSSSNNNNNTISSNNNNNN 223 Query: 239 WLDSNQLADKEEYEHKQKE 295 L L DKE EH+Q E Sbjct: 224 SLHHGPLRDKELTEHEQLE 242 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 23.8 bits (49), Expect = 3.7 Identities = 14/79 (17%), Positives = 33/79 (41%) Frame = +2 Query: 59 NEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIK 238 + A++Y + D + + + +++ + ++ + S ++ + N+ Sbjct: 164 SSADRYSADTDSKLRSERIRDSRDERDSLPNASSNNSNNNNNSSSNNNNNTISSNNNNNN 223 Query: 239 WLDSNQLADKEEYEHKQKE 295 L L DKE EH+Q E Sbjct: 224 SLHHGPLRDKELTEHEQLE 242 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 23.8 bits (49), Expect = 3.7 Identities = 14/79 (17%), Positives = 33/79 (41%) Frame = +2 Query: 59 NEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIK 238 + A++Y + D + + + +++ + ++ + S ++ + N+ Sbjct: 116 SSADRYSADTDSKLRSERIRDSRDERDSLPNASSNNSNNNNNSSSNNNNNTISSNNNNNN 175 Query: 239 WLDSNQLADKEEYEHKQKE 295 L L DKE EH+Q E Sbjct: 176 SLHHGPLRDKELTEHEQLE 194 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 23.4 bits (48), Expect = 5.0 Identities = 14/79 (17%), Positives = 33/79 (41%) Frame = +2 Query: 59 NEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIK 238 + A++Y + D + + + +++ + ++ + S ++ + N+ Sbjct: 164 SSADRYSADTDSKLRSERIRDSRDERDSLPNASSNNSNNNNNSSGNNNNNTISSNNNNNN 223 Query: 239 WLDSNQLADKEEYEHKQKE 295 L L DKE EH+Q E Sbjct: 224 SLHHGPLRDKELTEHEQLE 242 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.4 bits (48), Expect = 5.0 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +1 Query: 367 RASRAEHPEPEVPPPGLEALAPPSRRSIK 453 R H +VPPPG+E P + I+ Sbjct: 1740 RMEEGAHLSFKVPPPGIEFTLPSPKIGIE 1768 >X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein Agm2 protein. Length = 599 Score = 22.6 bits (46), Expect = 8.7 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +3 Query: 66 QRSTETRMTSKRRPSRPRMHWNLTASA 146 Q + ET R P+R W+ TA+A Sbjct: 409 QLTEETYQEGTRDPARTPFQWDSTANA 435 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 498,445 Number of Sequences: 2352 Number of extensions: 9726 Number of successful extensions: 34 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 50320221 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -