BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_P15 (655 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 27 0.13 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 5.1 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 5.1 EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetyla... 21 6.7 EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetyla... 21 6.7 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 27.1 bits (57), Expect = 0.13 Identities = 24/87 (27%), Positives = 38/87 (43%), Gaps = 1/87 (1%) Frame = +1 Query: 247 SIPGNILKLSNLRM-KLFIILTLCALAAAKPWEHTVLNDVIPEPSAPEEPPQLESLHTPQ 423 S P + L N R+ + F+ ++ L +E T + + + PEE +L Sbjct: 48 SKPVSFESLPNRRLHEEFLRSSVDVLLQEAVFEGTNRKNRVLQWREPEELRRLMDFGVRS 107 Query: 424 LPQTVEELVAELLKFIYNVVENGWPIF 504 P T EEL+ L K + V+ G P F Sbjct: 108 APSTHEELLEVLKKVVTYSVKTGHPYF 134 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 5.1 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 481 VENGWPIFNLPPLEPLV 531 V W +F+ PP EP V Sbjct: 28 VREKWNVFDDPPREPTV 44 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 5.1 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 481 VENGWPIFNLPPLEPLV 531 V W +F+ PP EP V Sbjct: 28 VREKWNVFDDPPREPTV 44 >EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetylase 2B protein. Length = 528 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = +3 Query: 288 EVIYHFDPLRPRGCETMGAYSPK*RYT 368 E I++ + P GC+ G + +YT Sbjct: 204 EEIFNGNRANPNGCQIRGTFFVSHKYT 230 >EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetylase 2A protein. Length = 535 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = +3 Query: 288 EVIYHFDPLRPRGCETMGAYSPK*RYT 368 E I++ + P GC+ G + +YT Sbjct: 211 EEIFNGNRANPNGCQIRGTFFVSHKYT 237 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,175 Number of Sequences: 336 Number of extensions: 2917 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16865010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -