BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_P14 (639 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19131| Best HMM Match : No HMM Matches (HMM E-Value=.) 174 6e-44 SB_21597| Best HMM Match : ig (HMM E-Value=2.9e-14) 29 2.4 SB_49314| Best HMM Match : 7tm_1 (HMM E-Value=5.4e-30) 28 7.4 >SB_19131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 456 Score = 174 bits (423), Expect = 6e-44 Identities = 79/121 (65%), Positives = 91/121 (75%) Frame = +1 Query: 136 PXYKMXIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVXXXXXXXXXXXXXXNFGIWLRYE 315 P YKM IF+PD +VA+S+FWYF+ QLK+ KK+ GEIV NFGIWLRY+ Sbjct: 226 PLYKMRIFAPDDVVARSKFWYFISQLKRMKKSQGEIVSCQQIYEKKPLQIKNFGIWLRYD 285 Query: 316 SRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAHSIQIIKVEVIKAAACRRPQVKQF 495 SRSG HNMYREYRDL+V GAVT CYRDM ARHRAR +SIQI+KVEVI A+ RRP VKQ Sbjct: 286 SRSGTHNMYREYRDLTVSGAVTACYRDMAARHRARGYSIQIMKVEVIPASKARRPHVKQM 345 Query: 496 H 498 H Sbjct: 346 H 346 >SB_21597| Best HMM Match : ig (HMM E-Value=2.9e-14) Length = 1931 Score = 29.5 bits (63), Expect = 2.4 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +2 Query: 530 VCTTTRDLIPSRTRGLALTSCNCNVRHITIKPM*KW 637 +C T I SRTRGL ++CN V + + P KW Sbjct: 820 LCDTCAFNITSRTRGLCPSTCNKTV-SVRVDPSGKW 854 >SB_49314| Best HMM Match : 7tm_1 (HMM E-Value=5.4e-30) Length = 300 Score = 27.9 bits (59), Expect = 7.4 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +1 Query: 427 SIQIIKVEVIKAAACRRPQVKQFHNSTIRFPLPKRVHHYKRLNT 558 S++I ++ AC P V HN +R + + VHH KR+ T Sbjct: 246 SLEITCFFLLHVNACCNPVVYSLHNPKLRKCMNRLVHH-KRVRT 288 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,424,867 Number of Sequences: 59808 Number of extensions: 378748 Number of successful extensions: 1085 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1024 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1085 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1608851125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -